SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FZK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FZK7
Domain Number 1 Region: 257-563,592-611
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.29e-65
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 619-920
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.07e-51
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 7-167
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-25
Family Duffy binding domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7FZK7
Sequence length 1389
Comment (tr|W7FZK7|W7FZK7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT90279.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_01211 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DITKLTPSLEEFAKRPQFLRWFTEWAEDFCNQRKKQLKKLEAGCKEYECNGSDERKTQEC
AEACETYQKFIKKWKNEYERQREKFKRDKDNEKYKDYPSTERDIEKATCAHEYLNMKLKE
FCGNKDCSCMEKPSSQLPKITQQSRSSDANDMPESLDYDPEEFNKCECPELSKKGSMIHT
KKIPEPKIPMNCVEKAAYYLSKEAENNLERTLKPKITHSNCVKETDNSFSSNKRCDPNKP
YAPDKYIGRRNPCENREENRFKLDSEWKCYKNIKLYQEKKRVCIPPRRENMCISNLDEIE
IAKVNQSNYLLNMVRIAARNEGIDIIKNFNSENGCAMNPICDTMKYSFADMGDIVRGTDM
LRIGGYLPPVEIKLYKAFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWKAMTCK
APEDAKLFRKGRMDGFESITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKALKVEL
EKLEKSCDHCKTTNKCKNDYDKNKCEKCKTRCQQYDNFILKWKTLFDIQSKKYKELYEPI
DTKNSTYDHVENFVQKLKKYKNECSVESVSEYLHETSKCLNYKFDENDGSSNIRSYAFEE
TPKSYKEACSCTLPSKNPLDNCPIDQNKDVCKELQTFTFCSKNDYDNNLDNWNAYLVLNS
SDDNKGVLIPPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKSEEELC
FEAMKYSYADYSDIIKGTDMMDTSLSEKIKKIFETSNEATENRKTWWEKNRSHVWHAMLC
GYISKNKNENVNPEWCNVPTEDGTDQFLRWLMEWAMQACKEKKHVRDSLKTKCRCSNEDN
FEASELLRQPGCQNDIRKYISLNILIKNSMENLNIKYKQLKDQSSDNIDNKPSEENVQLY
IKSKHSQCALELNDINEIDTGTKNNENNELIEVLKKLYPGSCFVENKAHKNHEVHQNKKE
AQADHPNVFYYFPFNLGSFYPGPLFSTHRGAQYDPKNDILKSSISVVIVSALGLIALHFM
KKKFKSSVDLLRILNIPQGEYGMPTLESKNRYIPYRSGPYKGKTYIYMEGDTSGDEDKYM
WDLSSSDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDISSDDIPSDDTPSND
TPRTNRFIDDEWNELKHDFVSQYLPNTEPNNNYKSADIPMNTEPNTLYFDNPEEKPFIIS
IHDRDLYTGKEISYNINMSTNTNNDIPMNARNDSYRGIDLINDSLSGAKPIDIYDEVLKR
KENELFGTKHPKRWKKDNDGGNVPIDNRTLNTDVSIQIDMDHGKPKKEFTNMDTNVDTPT
MDSILYDLERHNEPFYDIYDDDVYYDVNDDNKTSAHHNNLDVSSKVQIEMDVNTKLAKEK
YPISDVWDI
Download sequence
Identical sequences W7FZK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]