SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7G3I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7G3I3
Domain Number 1 Region: 465-766
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 157-434
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-48
Family Duffy binding domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7G3I3
Sequence length 1373
Comment (tr|W7G3I3|W7G3I3_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT91222.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_00820 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDK
LANGSLEMLESIGNDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDI
SNNNMNSLNSMNNLNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNI
CVSDRRVQLCTGNLIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKW
SYGDYGDIIKGTDMEGLGRSIKVEFEIDRIFKRDNEKSAENRKKWWEEISTHIWNAMIKE
HKEKFPKDVKECSADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKEE
ICKSECKKYKAWIDKKNNDFTILSEIYLKYNKKSSLYKTAFEYLKQKWDKYKELNFSSIF
DQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYCKEKGNDKIWQCINEH
IKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRDEGKFLIEKYRKNMHE
NMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNFEGIKANIVSMYPSYA
DLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDNQYLHWFREWKNDFCID
KLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWIINKRKEYKMQSSKYKR
DRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDICKSTVKPYDPEDIKDE
EFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKGGTQSSHVDQVGNTRE
SESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGRDVSSSPVGVGDEHEAKELLPPQ
KIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEEGSIITSDVAHGTNSLFGG
QIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVDSSSEMSSGGRGGLKT
KEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHINVLQGMDKHLENPPTS
ERGDSVLESEFSKLNRTSHTHDNNRIETTAENNIGGLSNSNVHDGRDSQRNRMHINSRSR
HGSLESDIVVRGDDISNIEGEGEEEEDANTLKYPRNVLNNKNSRTYNIEEYIYRDVNKVA
DDIMRSYKSNRCTNNLSSNYCSKLKKESLSNSCTNEDSKHLCCSISDYCMKFFNFNSSGY
HSCMRKEFSNPAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKSSILNWSEDNELNGTAF
EEANFEDAAFEVTTGQDSAFEDYDENAYRIGLLMNQKIQSAKSSDYLEYHVDN
Download sequence
Identical sequences W7G3I3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]