SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7J669 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7J669
Domain Number 1 Region: 57-95,125-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000261
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7J669
Sequence length 218
Comment (tr|W7J669|W7J669_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC74442.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_04881 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKVLFIALAFSFIGFPKRGEGRYLFGRNQMKSQDIEKNNKELSNKMDTQDSKQYITYLYH
SSICQYCSKVTSMLENNDNVEIIKFKENNKIEDFGKFTKPIVVLLKNINKENSLERSIFY
EELKRKGKKVQVPALEVNNIILFESDEIIKFYKKLLQKVSNDDKSSLQNRGNIKNDQKKN
NSDYDNDYDNDDNNDDNDDDDDNNYNNNNDDGYDYHTS
Download sequence
Identical sequences A0A024VI01 A0A024W2Y0 A0A024WL68 A0A024X272 W4J0T3 W7FJ51 W7J669 W7JP84
PF13_0270 gi|124513748|ref|XP_001350230.1| gi|23615647|emb|CAD52639.1| 5833.PF13_0270-1 XP_001350230.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]