SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JBA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JBA2
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.97e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-22
Family PDI-like 0.018
Further Details:      
 
Domain Number 3 Region: 430-518
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000175
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7JBA2
Sequence length 540
Comment (tr|W7JBA2|W7JBA2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC76055.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_03278 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAK
EYHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGEDYAQGGMGGGSPGRGEHAHGFH
FDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKFTSGGPSFNHFEDEYEDIYKNEVLKINS
KNIESVLNDISFSLIINFYSPTCSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
YNVKSLPQLILMRSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIE
IPKVLFFISHNDNIVMLKALSLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDI
DSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVTSYQELTKKKYESGQCHEKDS
QICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNIQYSN
GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGIPINQNIKRSLKFVHVEQYDDEL
Download sequence
Identical sequences A0A024V4L6 A0A024W6C6 A0A024X637 Q8IIR6 W4IRV7 W7FH05 W7JBA2 W7K453
5833.PF11_0099-1 PF11_0099 XP_001347774.1.26446 gi|124803627|ref|XP_001347774.1| gi|23496025|gb|AAN35687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]