SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JHM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JHM6
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-17
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7JHM6
Sequence length 516
Comment (tr|W7JHM6|W7JHM6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC78595.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_00718 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEVSTLIHRARIDSFDLKKRLF
YNILTLGSHYGFQAATNVISGLNRTISSFTRDQGQSRDSNSPDQTTQRDDGDEPPLPDGP
PGKVPATDQITNALLGSAIPLGVGIAFASLAYLLLKVKPKITSTRTNLFRVIDIPQNDYG
IPHKTSINRYVPYSSNLYKEKTYIYIEGEETDDYSYVRVISSSDITSSSEGEYEEMDIND
IYPYKSPTYKTLIEVVLKPSIKNEEAHNTEDAQDILIENMEDTNDTPTNKLTDEEWNKLR
NDFISQYLKDLPNGMDYQLPNEYTVDDNIYMDIEPNILHDSMDEKPFITQIQDRDLHNGK
QITYDINWNIQKRNEKLLVILQMIRNIFQIMIYILE
Download sequence
Identical sequences W7GBQ3 W7JHM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]