SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JHR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JHR1
Domain Number 1 Region: 55-489
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-85
Family Duffy binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 816-1152,1197-1216
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-77
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 1610-1690,1725-1812,1845-2015
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.03e-74
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 4 Region: 1255-1581
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-73
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 2692-2957
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-53
Family Duffy binding domain 0.0000274
Further Details:      
 
Domain Number 6 Region: 3027-3264,3310-3329
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-52
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 7 Region: 2325-2637
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-45
Family Duffy binding domain 0.00063
Further Details:      
 
Domain Number 8 Region: 508-674,720-739
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-30
Family Duffy binding domain 0.0051
Further Details:      
 
Domain Number 9 Region: 2008-2220
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-27
Family Duffy binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7JHR1
Sequence length 3737
Comment (tr|W7JHR1|W7JHR1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC74229.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_05095 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MARGRGGEEDPIEHNKDAKHLLDSIGKKVYKEVHKKAVDYRKYLKGDLKSAAFKDGNNNV
TDACHLIYEYDTNVTGGFDTNNPCANRLDVRFSDKYGGQCTNSKIKGNEEKDVKDIGACA
PFRRLFLCDHHLSYMEAGKINNTHNLLLEVLLAAKYEGQSLVKKYNEYKERHKDLPSDIC
TILARSFADIGDIIRGKDLFLGYNEKDQEEKKQLQENLKKIFKEIYDNLMEDLIKDPTKM
AEAQERYNGDKENFFQLREDWWDANRAKVWEAITCKAEQNDKYFRDACSEGTTSTQGKCH
CITGDVPTYFDYVPQYLRWFEEWAEDFCRLRKHKLQNAIKNCGGKDGRDKYCDRNGYDCT
RTIRGKKILVSDQECANCYVGCTDFVPWIKNQKQEFEKQKEKYDKEIKQKDQRTITTTHG
TINNTYAKEFYDKLRKHYPSVDEFIKKLNEENICTDELILLNEKVSPVNFTNGHSNKTFS
HTEYCDTCPWCAKKIKNKQGKWTNEQYDDCPNEQSTPVDLSKTTNINLLSTNIAEHNILE
KYKNFCGKGEKSANGKNGNQIVTWQCYYDDSNEDGGKNDNCILGEWKNFTQNKTIKPYEL
FFSHWIKRMLEDSIKWREQFNNCINNENATKCIKWCKTPCECYKKWVKRMETEWGDIKKH
FHKEKNHIDNHHFTTLEWFLELQFLPSIEEAYGNDEAIDKIEELLEERRTHADSELNDEE
KKDIIDYLLEHEGKDAEKCTTTHTDEEACTEEEKIHNNPCSEHVNKPTASVKDIARKMKG
HARKLLRNRGGRSALKANASQGNYSRGGKADDFKGGKLCTINDQHSNDTRRDSTGPCHGK
DGNQGGDRMKIGTPWSNIVEKNKTSYKEVYLPPRREHMCTSNLEHLITDSQGLSESKLAS
NSLLGDVLLAAKKEGDFIVEKLGGNDNSAICRSMKYSFADLGDIIRGRDMWDLDEGSKKM
EKNLVTIFEKIKDNLPQDIQGKYKGDSKHLNLRSDWWEANRYQVWNAMKCATLRDEKIPC
PGIPLDDYIPQRLRWMTEWAEWFCKEQYSLYDELETQCGGCMSKNKGKGGKGCTSGDSAV
CKQCKAACNTYGNKIKEWQKQWETISYKYLMLYLQTQIAAANGGLNTSVGAVNNEDKPVV
AFLQQLLPPKSVKPGAPTPTLTSPYFTPAGYIHQEMGQNVGCNIQTQFCEKKKGGKEKNE
KYVFKDKQHDQDTPCNCDKPPKKDACTTVNSLLQNRSATDDIEGCRQKDDGKIPYPRWTC
EIDKFQEGHAGACMPPRRQKLCLYYIAHESQTQNIKTDDNLKDAFIKTAAAETFFAWHYY
NSKNANAQEQLKAGKIPPDFLRSMFYTYGDYRDICLDTDISVKTARSDITKAKDKIGKVF
SNSDDKSPDGLTREDWWNTYAEDIWKGMVCGLSHHIKNGNKEQLRKNLTDNNKYTKISSK
LEDFASRPQFLRWFTEWGEEFCRERDTLEKNVEESCKDAQCNIDGTRTNKTECENACKNY
TTYIKDKKSEYNEQKSKFDAEKIKGNGLYVNYKDKEAHDYLKEKCLDGSCNCMEKVKDTS
DYWENYKKTYDNTTLQKKCECELPPKDACTIVKDLFEDNSEKKKYFDQACSLKYEKGKEK
YTQWKCINDTTSSPSGKETTSSTSTCIPPRRQKLYVKPIESLGGTSTVDLRTAFIQSAAV
ETFFLWHRYKEEKKREEKERKERQDGLYTLSSDHSDAEQKQLETGDIPEEFLHEMFYTFG
DYKDILFGYNIGSLKDMGEIEKKLKNVFRNTEKSTGGKTSNDTTRDHWWNEYGKDIWYGM
LCALTYDTDTKQLKQDVHDNLIKKTNNKYDYRKVKISSIPINSGNKSDTTLLQFTERPTF
FRWLEEWGEEFCRKRTDRLAQIKHECRGKYNNKHCDADGHDCKLTSPEKNKNLSDLDCPG
CQKECRIYNEWIEKKEKQFYKQQKKYEKLISTSNKETYKEFYKNLHSKGYTSINLFLESL
NRCKNGHDNNHQTYKIYFNKPDDTFSTSEYCETCSSYGVTCNRNYSCKKNTEKEWNKRND
LPNIPKKKNGITTNIDMIVNDSIGRHFDAHIRDFCNNCTLFKRTTDLNWECQYLNGIDQC
KIKNGVKSRFFGETIAFRMLFQRWLRYFVQDYNNAKENIKACIKKEDVKSNKCIIGCKDK
CECVEKWLKKKEEEWEKIKAHYDQQKEYYVYSIPHWVMSYFQQLPFDDYKKAQEVVENES
DRYKLWGCTGKNLENGNEKNCNKGDFISNLIDKLQKKIDNCKTKHETSGNPQPTCVEIPP
LDEEPPLDDDTTDKQSPDICKDVGDTKEPETDSEKLCDSKKQPKCNNLENDLRSTCKPKV
KLIGLEARNLIAGIKSNIYISPRVQQLCLEPLQELAKSNAGATDKSKLIKAFTKCAYNEG
KGLYEYYSKNKNELVKNVSTLSDKDVETYTLEAMKRSYADYGNIVKDDMLWNYDNSYDIN
EIIFDIATQHSKSQNTHSSDYETKERQNLWELIKTHVWKAMICGYKDAVRGDITSLPNGV
DLCTLPSIDKDDQFLRWFEEWGQNFCIRREQEIKRLNEKCHNLICNSTNEGEKQECKILC
DNYKEFLKSYANQFKKQSIVYDELKKSIPELRNKTALWFLKEKCKSKFSCFEKNDQIEVS
KIFEYFSDDVKDECVCKEDKSLPDDKVNDLDKCPTEKKNNICNTYKKRRMCTYSNNRNSL
EYWYGKDMLIPPRRRKICLRNITGYTFYKTNDGKNKFKNALLSAAMSEASFLCNNYEDKR
EALQAIKYTFADIGDIIKGKDMVDDTAYKKIKVKLENVLEKTGNDPIATEKWWDQNKKHV
WNAMLCGYKEAGGKIESDDCNIPSEENTDQFLRWLIEWGKQVCKEKKELKASVYKKCANK
DRKVDESCNYAASSYNNWNKIVKHAYDGLNKKYENFKLSQSGSTLTQKDADEYIKEKCSE
CQCSFEDIEETFKKNSETNDEVLDVIINKSHIPPHLEDIFNRYNGPYLRCPDSKLCIPYK
NIPCFGNEHDDDGDWNSSLVRYNKTTNWGVLLPPRRIHLCLRIYPEKFVYLRNDIKHFKN
FICSSAFAEAKRLKKVYKDDNDKLLQAMKYSFADIGSVVKGNDMMESPTSKYMDKLFTSN
KYSGINRETWWNENKYHVWESMLCGYREAQGDTKKSENCRFPDIERVPQFLRWFQEWTKI
FCTKRNELYDKMVSACENAQCDNKIGNVNVSDCMKACEKYKYYVLSKKKEYDIQKNKYDA
AFKRKNDNKEAHDYFKDKCKDGQCACLYEKFNSDNNWENPYQSINDSKLKDKCKDGQCAC
LYEKFNSDNNWENPYQSINDSKLKGKCDCQKTVPPPLVPPSPPPKPDELPIPADEPFNRD
ILEKTIPFGIAFALGSIAFLFLKKKTQSPVDLFSVINIPKSDYDIPTLKSKNRYIPYKSG
PYKGKTYIYMEGDSDEDKYAFMSDTTDVTSSESEYEELDINDIYVPGSPKYKTLIEVVLE
PSGNNTTASGKNTPSDTQNDIQNDGIPSNKITDNEWNTLKHDFISNMLQNQPNDVPNDYK
SGNSSTNTNITTTSHHNVEEKPFIMSIHDRNLLSGEEYSYNVNMSTNSMDDIPINRDNND
VYSGIDLINDTLSGNHNVDIYDELLKRKENELFGTNHPKHTTINRVAKPARDDPIHNQLE
LFHKWLDRHRDMCEKLKNDNERLAKLKEQWENETHSGNTHPSDSNKTLNTDVSIQIDMNN
PKTTNEFTYVDRSGQTI
Download sequence
Identical sequences W7JHR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]