SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JML8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JML8
Domain Number 1 Region: 53-330,360-481
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.16e-80
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 878-896,927-953,980-1012,1052-1156,1227-1404
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-71
Family Duffy binding domain 0.00091
Further Details:      
 
Domain Number 3 Region: 1765-2062
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.15e-53
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 4 Region: 2095-2381
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-41
Family Duffy binding domain 0.00044
Further Details:      
 
Domain Number 5 Region: 474-707
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.16e-32
Family Duffy binding domain 0.0029
Further Details:      
 
Domain Number 6 Region: 1401-1636
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-27
Family Duffy binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7JML8
Sequence length 2823
Comment (tr|W7JML8|W7JML8_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC76144.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_03186 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAASTTYSSAKNAKEFLDMIGETVHHKVHAAALQPSNGKLKGHLSQAKFEDAPKDKQTEN
DPCKLKYGYHTTVTSGYDNENPCKDRPEVRFSYTEGAQCHSKKIRGSNGKNEGACAPFRR
LHLCDHNLENISDFDHINNHTLLTDVCEAAKFEAESLEKYRAQYQEKYGDVGSPICTVLA
RSFADIGDIIRGKDLYLGNKKEKEKLENNLKTIFKKIYDNLKNTDVQKHYSDDDEGNYYK
LRNAWWEANRQEVWKAITCGAAGGKYFRNTCAGGRSPTPNKCRCIAGEVPTYFDYVPQYL
RWFEEWAEDFCRKKNKKIKDVKRNCREEDKYGNERYCDRNGFDCERTIYKKGYFVIDKDC
NTCSVSCRPYESWIDNQKKEFEKQKKKCENEISGNSRKKRSPSNKNYEGYEKKFYDILNG
PDVGGLDKFLELLNKEEVCKKITTQEEGKIDFKSVKSSSTSGDGDGSNKTFYRSKYCEEC
PLCGVEKGNNGNEWKDKDKSGKCDGGKRYNIPKDTQHNVIPVLSFGDERDQIKSKIDTFC
KTQNGNSGKPSSSGSGDCGGNIDSSLCEPWKCYKEDDIEKHVQHVLEYDKEVKGAGGLCI
LQNKKEKKTDNDPEEFQKTFNDFFYFWVGRLLNDSIEWREKLGKCLEKKNGNRCRNGCNT
KCECFLKWVNRKRTEWDKIKKHFKTQDFGDGALLGAFSPYYVIETVLELEYFPIIQEAYG
DARAIQGIKNMLEEKKQERNADTSKDKTIIDYLLDHEKKDAEKCKQKQEECEKKKQKQAT
SGLARSETHGPQTPRDQEDEDEEDDDDDEHSEEGGDDQEETENPEQGEVDEPQAAVDEEV
VEEAPQVPSATTTQDGVKPPCEIVDDLFKETEDFKVEACKQKYALPQRHWGWKCISDTTT
TKPGESGEPKGRHRRDTSAVTTTTSSSGATCIPPRRRKLYVGKLHDWANTVTQPQGEASS
TSEGKTATQPQGQTPSQGSPSATSSRAQSHPLLTAFVESAAVETFFLWHRYKKEWELQKN
KAQNGLLGEAEGVQPLNGTLGDDPQTQLQQTGVIPPPFLRQMFYTLGDYRDICVGNVPSG
IDKVSASGNTKGESDMQKIKTAIDEHINSLKQADSVPKPQPPVQQQQNSSLTRETLWETF
APQIWKGMIYALTYNTDSGTKDQPPTQIKDADKLLDKLKKENGKEGEYHYENVKLENSET
SSAMSTGPRTTQIASPSGGDPKPNTDDITTPTLTQFVVRPTYFRYLEEWGETFCRQRTRM
LEQLDKECRGVNSSGNPKYCSGDGNICDETRAQSQNTFISLHCSDCLKECMKYKKWIDIK
FEEFQKQKSKFDRELQKLKANHNGDNKEFCDQIEKKNTAADFLKALRHCKDDEVHEEKDN
DNKIDFSEPLKTFSPTTYCKACPVYGVNCNGNKRGKSATNGCKPKGEPQNAANTVDGEQT
LIEILIDDGSNHSATDGATNGTTDGIDEELRNCSEKYNFFKRLRKQEWTCQKKKDGIDQC
NLTKPVAKTDDDKNIWFNEFFQRWLRYFVQDYNKLKDKINPCIKNENEKENGKEDKCING
CNIKCECVGKWLEIKGNEWGNIKKHYNINSNDDKETIAYRIKSYFVEQLHFDKDHKKAQD
VVEDKDQKKRDELWGCTGNITCETEEKKIKYGDFIANLIKKLKEKIESCPSQPDETTHPN
CDETLPHSDEEENFEDTPTTDDSQSPAFCKDIQPPEEPKEDSDRLCDDKKELKCNDLKID
MNTTYKPKIKLIGLGAHYYKGGVDYPNVYVPPRVRQLCLQPLKELAESNEDTRYKNKLIE
ALKKCAYNEGKGLYEYYNNNKDILGLNASQLLENEIETYILQAMQRSYADYGSIVKGDIL
WDYEDKEKIDLKIIDFAKNHKSTTTSSVSTSDDVKRRKLWESIRAHVWKAMICGYENVGG
SFDNEDLKCKLPDTENTYQFFRWFVEWGENFCIRRKQELSLLKSKCPHDICSNQDEHIKK
ECKNACEKYEQFLINARTQYKNQVIEYDKLKYFYNYTRKKGAVEFLKDRCNTKCICFQEK
SGNYNNKAFAYPPDEVKYQCNCESSPDNPFNVLNDCPSDNTKNSYCKNYNLENLCEKSHS
NNFYNWKIVRVKNKKNRNEIILVPPRRRHLCRIPFMGKWYYKNKKGEENLKSHIYTAAYS
EGYRLSKLYKKKPENVLEVMKNSFADYGNIIKGDDMLGTDIHKKLNVLLDKSKNPKTPEA
WWETNKKHIWYAMLCGYQKGSDTEKLDESWCSIPTEDGTDQFLRWVVEWAKEACKEKKIR
ENSLGKKCNCANQDEKSGLPLLKDSTCINELEKYLKFNILVKESLEQLNIQYSINKTCLI
SEKTVEEYIKSQLKKDNCDLSDIQNNYESPTNLKNDIYKKILKNHCPHINFETESTKKDD
FAPVQPPSSHNTSDILTTTIPVGIALALGSIAFLFMKKKTQAPVDLFSVINIPKSDYDIP
TLKSSNRYIPYVSDRYKGKTYIYIEGDSDEDKYAFMSDTTDVTSSESEYEELDINDIYVP
RAPKYKTLIEVVLEPSGNNTTASGKNTTASGKNTPSDNTPTPQPITDNEWNTLKHEFISQ
YLQSEQPNDVPNDYSSGDIPTNTNITTTSRHNVEEKPFITSIHDRDLYSGEEYSYNVNMS
TNSMDDIPINRDNNVYSGIDLINDTLSGEPINIYDEVLKRKENELFGTNHVKQTSIHSVA
KLTNSDPIHNQLELFHKWLDRHRDMCEKWENHHERLAKLKEEWENETHSGNTHPSDSNKT
LNTDVSIQIHMDNPKPINEFTNMDTILEDLDKPFNEPYYYDMYDDDIYYDVNDDNDISTR
NIL
Download sequence
Identical sequences W7JML8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]