SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JQ82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JQ82
Domain Number 1 Region: 339-392,432-457,492-514,546-642,688-857
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-79
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 862-1079
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-39
Family Duffy binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 16-196,230-249
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.72e-28
Family Duffy binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7JQ82
Sequence length 1679
Comment (tr|W7JQ82|W7JQ82_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC87143.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_03919 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
GGGGGSGGGGGSGSKSDSQKLYEEWKCYKHDEVQKVQGQGEEEDEDEVEEEDDLKSAGGL
CILPNPKKKEESEAKSQNEPEQFQKTFYDFFTYWVAHMLKDSIHWRTEKLDKCINNTNGK
QTKCRKGCKGDCDCFLKWVNEKKTEWGKIKDHFKTQEGLDNEGENGIPESTRFGFTHDVV
LGEFLELQFLNENNEENSKNSLDSEEIKHLKNLRDIIKKKNQQAGAGATGKRTIMDELID
YEEGIAKDCQQKCQETQKPQQVDRDLARSATGPRDPSSPAAPTAGPVESAAVDDEDDDNE
EEEEEEEEEDEKEEVGGSDVVEEKEEKEEEKEPEEQVEPQPAATTTQNDVKVCDTVDKLF
KDTTALQDACNLKYVKGKNYGWRCVAPSHTTSETTGKSESATSSSGATTAPAPSLTSPQA
TASANSANSVSSAVCIPPRRRRLYVGKLEQWASGGNTQGGGGNTQVTPQAGGSEAQTQPQ
GKDAASTSPQVALLRDAFIQSAAIETFFLWHKYKMEKKKEKEETQGQVYKQTDDEDKTPQ
ELLNSGKIPDGFLRQMFYTLADYKDILFSGDKDKKNGYSDIINGDKEMKAKEEKIKEAIQ
KFFEQTRGAIPPPPSGTTPSSWWEQHAESIWNGMICALTYTDNSDTVAKGKASITQDTDL
KDALWDENGATNEPIKYKYTEATASGDNTPLTQFVLRPPYFRYLEEWGETFCRQRTRMLA
KIRGECVKSGSERCSGDGEDCNDQLDADPTIVRDFLCSTCGRHCSFYKKWIQRKKEEFTE
QYNAYGGQKTKCQTESETAKEFCGTLNTFNDAAKFLERLKSGPCKNNENVEDNGKDKLDF
SKPNETFVPATNCKPCSSFKIDCKKAKCSNRDDTNVGFNCKKNGNGYITSDHIKNEDNFT
DTIDMLVSDDNKNKSETVLEACEGADIFEGIKENKWKCGNVCGYVVCKPENGNGKIVNGK
PNGENQIIIIRALFKRWLEYFLEDYNKIRKKLKPCMNNSDGSPCIDNYKKKYQCVLQWIS
RKEEEWKKIKEHYEKQKPKNGDNNMKSLVTDILSGLYPQTDVNKAIKPCKGLTKFESFCG
LNRTESSKIKDGTPKDVVECLFQKIQKKIEECKQKHPQPSANNCTTSPTSDTPPDDEEDL
LHEEEENQVKAPEICPTPQQEPEAEDEGECKAASPATSEEQTNQTSNPHETPVLKPEEEA
TAPTSPPRPPLVTSTLAWSVGIGFAAFTYFYLKKKTKSSVGNLFQILQIPKGDYDIPTLK
STNRYIPYASDRHKGKTYIYMEGDTSGDEDKYAFMSDTTDVTSSESEYEELDINDIYVPG
SPKYKTLIEVVLEPSKRDTQNDMPSDDIPSDIPNSDTPPPITDDEWNQLKKDFISNMLQN
TQNTEPNILRDNVDNNTHPTPSRHTLDQKPFIMSIHDRNLLNGEEYNYDMSTNSGENNVY
SGIDPTSDNRDPYSDKKDPISGTKDPISDNHHPYSGIDLINAALNGDYDLYDEILKRKEN
ELFGTNHVKQTSTHSVAKNTNSDPIINQINLFHKWLDRHRDMCEKWDTNNKKEELLDKLK
EEWNKDNNKHNGENTINKTLNTDVSIHIHMDDPKPTNEFSNMDTYPNNSSMDNILDDLEK
YNEPYYDVQDDIYYDVNDHDTSTVDSNNMDVPSKVKLEMSVKNTQMMEEKYPIGDVWDI
Download sequence
Identical sequences W7JQ82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]