SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JSG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JSG1
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-41
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7JSG1
Sequence length 3531
Comment (tr|W7JSG1|W7JSG1_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC87671.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_03519 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKTMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEEKPVEEKSVIEEKNVSEEIPVEEENVSEEIP
EGGIAIEDVPVDEETVTEEITVDEKIYDKLPNEIETVNEEMPVEDETLTEQISSEHERVP
EEIIEEKPFTEGEETESLTDEIVEEGVVTDDIPEEQIITEKVQEEEEFVTGELSEEDIIN
EKVQEEDESVTEELPEEDIINEKVQEEEESAYQEIVQDGSVTKDVEYKELVNDDVRDKEN
FVIEEDPFKGQLINEGLPVEEEFVTKELPVKEESVFEELTEEDQSVTKEIPVEEHSVFKE
VDEIESVTDEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEEVEETELVNEEVLKEEGSAS
EKVVKEEGSASEKIVEEEGSVTEEKKTMDEEIGDQGSVAEKVEEEELVTEEVIEREGSIN
EDIVKEASITEEVEQIEPVTGKVEKIESITDEIKEQLVPEDIKEEQLDFEEIVAQRASVN
DEKVEVASITEEVEEEEKSVSEEVLEEEGSTTEKVVKGSSTEVVVEEQGSVTENLLEEES
ASQGIVEKEEFVDEEDSVKDQNVFEKEGSVTEQLVEEEKGLINEDNEKEELITEMSEEIK
SVNEEIEETDLSTEEIIKQQGLATYEFVEEEKSLTDKLLEEESVTKEVGETELSTQEVVD
EKVSVTEEVIEEEKSVSEEVLEEGSATEEVVEEGSCTEVVVEEGSCTEVVVEEGSCTEVV
VEEGSCTEIVVEKGSDTEIVVEEGSATEIVVEEGSATEVVVEEGSATEEVVEEGSVSEEM
LEEEGSATEEVVEEGLSSDNVQKSKGVIENVGEIYSVKTAKDESMNEKIPLEKSSFVDDE
SFKGQGPTDNVSVEDVNSEDIINEHTPLEETKIEELPTEYITTADIHTKGETETKYNLIY
EKINEEVEKAKFQEEKITENIPVERESVTEDIVQEPSLAQEVEQKESDTNEIEETKLANE
KIIPEVSVTENVVEKEGLDTEEVLEEDESITEEIVEEEVSSSEEIVEEEESSSEEIVEEE
ESSSEEIVEEEESSSEEIVEEEESSSEEIVEEEESSSEEIIEEVSSTEEVLEEEGSVTEE
IVEEEVSTTEEVKDIGSVSEEVLEEEGFGTEEFVGQQGSVIEEIVETESSTEKVLEDVGS
NVEEIVQEEGPVAQEIVHEEVSTTEKHDEVDRSTTEEIVEKVGSVSEEIIVEEVSASEEI
VEEGSVTEEVVEEEKLINEVGETESVTEEIVQKEVSDAEEVLGQEGSMNEEILEKESIVE
EIVGPEGSVTEEIVDHGSFAEEVKEEELVTEEAVQYEGSVTEEIKEEESITENEAIEESA
FAEIIEEKGPNTDEIVKEEGLDTEEIVNEVSVTDEVIEEEKLVNEQIVGEERSVTEKPVE
VERSATEDLVEEEASVTEKVSVHEGSTTEQILDESVAEEIVEEEVSVDDKIIEEEVSVDE
VVEEEGSVIEEIVEEEESVPEEILEEELSGSEEVLEDEWVTDAFMGQEGSVIEEIEEIVD
GEGSITEEIVEDGSANEKIVEEEPSRVEEVLGKEGFVIEEIIEEGSVIEQVEDTKTVSEK
SEESSAIEEVKEVKEEESISEKIVEKEESVTEEIVRQEESTTEKIVKDVSPTEDFVEQTD
SVTEKVIEQEGSNTEVAEDVEEKESASDEHEQEDVSVNAQVTYEKKSVTKEIVDEVSRTE
EIVEENGSVTEGVDETGSVTEEIIEEATVTEEVVEDGSVTEEVVEDGSVIQEVVEDGSVT
EEIVQENGSVTEEIVEEEGSVNEEVEEEVSVSGEVDETEYVTEESVTEELVDEGSVTEEV
VEQGGSIAQEIVEEESATEEIIRDETNVEEVLEKEGSATEEIVQDGSGTNDFVGKQGSVI
EEVVEEEISTTEEKLKEEASAIEEFVEEESIREDVLEESLVTENVVGQQESVTEEIVDGE
GSFTEDIVEEEESVTEEIVVDEESVTKEIVEDEELVTEEIVEDEGSFTEEIVEDEGSFTE
EVIEERSLIEEVEDTETVAEKEEGSVIKEIIDEKSLTEKIVEEEKSVTEEVEEKESVKEE
VEEQRLVVEEEGSATEGIVEDRLATEGIVDDILVTEEIVEDGLATDEFVEQQGSIIEEVL
DDEGSVTEEIVEEEGSPNEEIVEGVSVIEEDDNIEPVSEEIVEGSVTEEMIKEGLENEVI
LDEDSITEEALEKEGSVSEEIVEEMGSLTEEIVDEERSTSEDMIEEGSASEEIIQEESQV
EEVVEEVSVIDEIVEEDELDTKEVVEEIEFNTEEVVEHKEEEGSVAEEIVQEEKEGSVNE
EIIEEVGSITEEMVEQDVSDNEEIVEERSVIEEAEENVWIEKEVEEEGLDNEEVIDEEDS
VSEQAEEEVYINEEILKESSDVEDVKVENELMNEEVNEETQSVAENNEEDKELDNYVVEE
TESVTEEVVVDEVPNSKEVQEIESIIEEIVEDGLTTDDLVGQQGSVIEEVVEEVGSDSEE
IVEEASITEEVEKKESVTEDILVEESVTGDILVEGSVTEEVVGEEKLVSEEIVTEEGSVA
QEIVEEDAPATEEIDEIESVTEEVVEEEGPVDEEIVQEEGSVTEEIIQGESKVEEVVEEQ
GSENEEIFVEEVSASQEIVQNESGTEEILEKVSASQEIVQDGSVTEQIIEEQKPVTEEVV
NEEESITHEIIQEESHVEKVVQQGSVAEEVVENPVSVTEEIVEKEGSVTEDIGQEGYVAE
EIVEEEEFDNEEILEEESVAEEFVEEGFDNEEIFVEQISDSEIVKEENSVNEEVLEEEGS
YTEEILEEEGSYTEEILEEEGSFTEEILEEEGSYNEEILEEEGSKKLKKNN
Download sequence
Identical sequences W7JSG1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]