SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JX87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JX87
Domain Number 1 Region: 783-1125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-81
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2503-2519,2548-2613,2647-2742,2769-2952
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-77
Family Duffy binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1596-1925,1957-1976
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-76
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1983-2354
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-76
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1219-1566
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-74
Family Duffy binding domain 0.0000667
Further Details:      
 
Domain Number 6 Region: 97-469
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-73
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 7 Region: 2957-3164
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.28e-38
Family Duffy binding domain 0.0035
Further Details:      
 
Domain Number 8 Region: 460-670
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-30
Family Duffy binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  W7JX87
Domain Number - Region: 3673-3747
Classification Level Classification E-value
Superfamily EF-hand 0.0163
Family EF-hand modules in multidomain proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7JX87
Sequence length 3989
Comment (tr|W7JX87|W7JX87_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC76141.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_03190 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGGNSSKVAPTYFTNESYNSTRNILENLAKDIKGNVSNDAKKKGISLKGYLRQAKFHHPF
SEHRPNYKTPFDLDYRFHTNVWKDKAYERDPCYGRQAKNNSNLEGAVCTNSKIKGNENKI
SDTGACAPYRRIHLCDYNLEHIHEGNVITTDDLLGNVLVMAKSEGESIVNSNAHNGMLNV
CTLLARSFADIGDIIRGKDLYLGNNESEKKKKEELQENLVNIFKKFKDRYVELKNVPIDD
IREYWWALNREDVWKALTCSAPYNAHYFIKSSASDQSFSNPKCGHGDNEVLTNLDYVPQF
LRWFEEWAEHFCLVRKYKLEKVKEACRGKTGGMYCSHNGCDCEKTIGKIRHFVWDHKCNK
CSIECGRYENWMKDQKLEFQKQVKKYEKEINVHNSIHDSTNNNINNKYYKDFYDKLKHEN
YGTVDKFINLLNEGRYCKEQVEEKISLDFNSSVDETFSRSQYCQVCPDCGVVCKNGTCKE
KPNDGNCGKNVNYIPPPGVNPTDINVIYSGNEQSDITQKLKDFCTDPSKDMGKNYENWQC
YYKNGDDNKCQMTSLTQTDEKHRYVMTFHAFFDFWVRNLLMDTISWETDLRNCLNNTGIT
ECDNECNKNCKCFQSWVDKKEIEWKNVKNVLGNQNKTLDNFYKKLNGLFEGYFFQVIYKF
NQDETKWNKLKENLKKKIDFSKGKADGKNSEGAVELLLEYLKEKATICKDNNTNEGCASS
KKLKTNPCGKNTKTGSDKVISVKQIAQYYKRKAHAQLEESGSRRALKGDASQGKYSRTGR
ASDFNNNLCGITQKHSNAHGNKSRNPCYGKNPERFNIGKDWSHLDKKQKSSYTDVYLPQR
REHMCTSNLENLNTKNRGLSNSSIASNSLLGDVLLAAKYEANFIKKKYNHDNNPKGFMDK
ATICRAMKYSFADIGDIIRGRDLWERNGDMVKLETNLKKIFKNIKDKLPGDIQEKYKEDK
EPYTKLREDWWEANRDQVWKAMQCPTTTKPAVIIIKCGTDTPLMDYIPQRLRWMTEWAEW
YCKAQSKEYKTLEDTCSECKKKDKDCTKNTEECNKCKKACSEYKNKIKEWADQWKQMEGK
YKKLYEHARVDIAANGGLNTSTAIKDNEDKPVIEFLFELYKENGGEIGNPAVARATVNGI
STVDTTPTVYSTAAGYIHQEATMNCHKQTQFCEKKHGEIPSSDTEADPTYAFRDKPHDYD
YALGCDQRDKLAPESKKTKKEAPATPALCDKVKTLLDQSKGGTVRINGCNPKEEPFIWKC
EHSLFQNGNHGACMPPRRQKLCINDLKSLTNDSSEEELRKAFINCAAKEIHFSWKKYEDD
KQKETPKYDAREELRKGKIPEDFKRQMFYTFGDYRDLCLGKDIGSHVDTKNISTNVQNIL
EKQNGQHRVPKLTADDWWEKNAESIWQGMLCALSYDTTKKNMDYEAQKELNSNYNYNTIK
DDLADFATRPQFLRWFIEWSDEFCREQKKQLDILKEKCPDDTCTKGQESKKEPCKNACEK
YQQWLKDWKENYKTQSEKYFKDKAGGKFQSTSAKDEVTASQYAYGYLNKALTKLCGNGNC
KCMDGESKETTGQPDNSHNSSMPASLDEEPEEVKGRCKCPPPPDACKIVDGILNGKSATD
YIEGCKERDDKTNPYSPWNCDKIKRGEEGACMPPRRQKLCVISLQYFTPKTSDGLRKAFI
ECAAIETHFLWKYYKTKNPEAEDELKKGTIPEKFKRQMFYTFGDYRDLCLDKNIGNDVSV
VENYIKDVLTDSTKNGETQTTADDWWKKIEKEVWDGMLCALEKAAGKTGALTTKYPYTYS
TVRFSDDKNAPTLEEFAKRPQFLRWMIEWGDDFCKKQSLAYKELVDGCNGYKCNGKNGKH
SKKEKCRKACEAYKKLIEKWKPEWEKQSGKYDKLYQKTQNGANDSPEEEKHVVEYLSKLI
KTRGTSDSNTYDSAGKYVNQKGYVSDCQQQTDFTTSTNNKHYAFEPYPYDHEDKCNCKDD
TRTQEKKKEYDDVCNTVKKLIGDNNGMSGRIESCNPKTEGPYPEWKCGDKKLVTDDNVCM
PPRRQKLCVSSLTQEGKIKNKEDIRTHFINCASIETHFAWHRYKNHNANADSELKTGKIP
EGFKKQMYYTFADFRDIFFGTDISSCPNIKKASENIKEILKKGNEQKNETQMLDKWNNSY
GPKIWHGMLCALEKAGGKGNIKSTYTYNKVTFSDDKTTTLEEFAKRPQFLRWMTEWGEDF
CKKRKEKVDKLVEQCRGCDVSDSTGGGDTKTCEKDSQGCKKCTKECETYQGWLKDWKDNY
NKQKDKFKIDKKNDADAKTSEHAYQYLGKKLKNITCTSATTRVNCDYKCMDQRSSTDGMP
ASLDEEPQEVKGKCSCKPPPKKPEVPPARPPPEPPRYVRHDYRARSERGEDGPLPLPLPP
PKKTPASRGRSLKPPAQPPPPINPAGRSLPPADRTGDLSDSEEEEGEGEEETAKESATEQ
DGGNEENVDQEGSVPELPGPAGPQVNVCNIVSKILTKDALQDACKQKYDGKYYGWRCVNT
TGSAEGEAASSNPRVRRSAPSGSKSDASGSICVPPRRRKLYVGELTKWASGNTQAAVSPP
EGASPSNPRADGLREAFIQSAAIETFFLWHKYKMDKEIEKKEKEAAQGKVHELKDDNDEA
QNQLKKGIIPEEFKRQMFYTLADYRDICIGVKDDDVIKALKDSGDKNIDTITNKIKQILD
GDNYKPDSVSQQQPSGDKREKWWDDYAKYIWDGMLCALSYDTTNKNMYPELRKKLTTDTT
YKYNDVTFKGGFNDNTTKLINFVKRPTYFRWLEEWGEEFCRKRIHKLDIIKKDCRGKEGD
EKCSGDGFKCTQIVENENGTITGLDCPGCAKYCGFYKKWIEKKKEEFTEQEKAYGGQKKQ
NCKEGSDKAESDNGVCGTVTTCDTAGDFLERLKIRSCKKDNDSGEDNKGNGYIDFNDKEK
TFGHETYCDPCAQFTVKCQKDKCRGDGTKANCSRGTITTGNFNTMGQPTEINMLVSDNGG
TEFTGDLEDCNGKGIFKSIKENKWKCRNFCGYVVCKPEQGNENENKSQILLFNALLKRWV
EYFFEDYNKIRKKLKPCMNSSEGSPCIKGCEQKCKKCVQQWITKKREEWEEIKKHYLKQY
ENTDSADSFPVKTFLEELIPQITDANDKKQIIKLSKFDNSCGCSAKPNSERNDGHKDAID
CMLNKLQQKAEKCQQDHKPSDETHQTQCQNLSPVEDEDDTLHEEIQVKAPNICPTPPKPQ
AEEKGGCKTDAPQPDVKEEEEEKEEETDKEDEEEEEEEEDEEDEAEEEEDEEEEAEEDDE
DEAVTHTSSPSEPQPKGLPREFPSTQLKNAMLFSTILWMVGIGFAAFTYFFLKKKPKSPV
DLIRVLDIHKGDYGMPTLKSKNRYIPYRSGQYQGKTYIYMEGDSSGDDDKYAFMSDTTDI
TSSESEYEELDINDIYVPDSPKYKTLIEVVLEPSKSDGNIPHSGDGNTLGDDMVPTTNTF
TDEEWNELKDDFISQYIQSEPLDVPQYDVSTELPMNIGGNVLDVGMEEKPFITSIHDRDL
YTGEEISYNINMSTNTNNDIPKYVSNNVYSGIDLINDTLSGNKHIDIYDEVLKRKENELF
GTNHVKQTSIHSVAKNTYSDDAITNKINLFHKWLDRHRDMCEKNHYITRTPKATTRTLCE
CELYAPSNYDNDPEMKEVMDNFNRQTQQRFHEYDDRMKTTRQKCKDKCDKEIQKIILKDK
IDKELTEKFATLQTDIQSDSIPTCVCEKSLADKTEKFCLNCGYGLGSVAPNIGLLGGPGI
YVWKIAALATAKELAEKAGAAAGEAARIKEGINAVIAELRALGIEKFGGSALKFVFDETN
YTEVLFINNIVYTEYHRSCDGPLLRASETICRKMIGKVIYKESATEEAAIESTVKAMVLE
TKTVADAAAETATQEVTSAAIKTNTAAVNATYSSCHTAIIASIVAILIIVLVMKKKNEEK
TPIYQIIERIDMFCYIDFGRKFGTRTVFL
Download sequence
Identical sequences W7JX87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]