SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7JXY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7JXY1
Domain Number 1 Region: 73-475
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.18e-77
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1232-1599
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-74
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 2053-2393
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-70
Family Duffy binding domain 0.0000564
Further Details:      
 
Domain Number 4 Region: 792-1138
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-66
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 5 Region: 2527-2836,2865-2884
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.93e-63
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 6 Region: 1623-1953
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-57
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 7 Region: 2891-3156
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-48
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 8 Region: 510-718
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-31
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7JXY1
Sequence length 3164
Comment (tr|W7JXY1|W7JXY1_PLAFO) Erythrocyte membrane protein 1 (PfEMP1) {ECO:0000313|EMBL:PKC45898.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=CK202_3585 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGNEQSSSSSEGAKNPSIIESQNSPRNVLERYGEGIMIKEKDEARIYENSLKGQLKQAKF
RGGPSTSVDEQYYYYPYPCSLNHNEHTNIRHDNVDERHPCHGREQNRFGEGQISECSNSK
IKGNENKSDGGACAPPRRRHMCDKNLEALTVENTQNCDDLLGNILVAAKYEGQSIVNNYP
DKNNSNNKSSICTALARSFADIGDIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAE
LSKLSLEKVREYWWAIHRKELWEALTCNAPKGANYFVYKLDGPKFSSDRCGHNYNGDPLT
NLDYVPQYLRWFDEWGEEFCRKRKIKLENVEKACRKDSEKLYCRHNGYDCTKTIKNENIL
FDDPKCTDCLIKCSLYEIWLDNQQKEFEKQKEKYEKEIQTYISNNEISNNNISNEYNKQI
SEKYTDKKYETLDKFLNLLKEGKYCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCEVD
CENGNCEVKNKPDGNCGKNVKYKPPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNIN
VKNNETWKCYYKNSDNNKCKMESNSENNKGAEKITSFHEFFELWVKNLLKDTMKWENEIK
DCINNTNITDCNDECNKNCVCFDKWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFES
FLFKVISELDQGEAKWNQLKEELKKKIESSKANEGIKDSESAIELLLDHLKESATTCKDN
NANEACSSSQKSSPNPCADKSGGKLVSVKQIAQYIKRQAYEQANYRSDGLHKLKGKAHEG
KYKRKGRENYFKDKLCKIGKYHSNRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIY
NDVYLPPRREHMCTSNLEHLVTDNKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDY
EPVSDEQSICRAVRYSFADLADIIRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGK
YTNTDGKYLELREDWWEANRAKVWEAMKCAIKGLNVTSSDGKLSDHCGYSDHTPLDDYIP
QKLRWMAEWAEWYCKVQSQEYDKLKKSCVMCMQKDNGKNCWKHNSECGVCKGACTAYQGK
LLPWEYQWNVISHKYETLYEKARIAADNGGLDTSSGDIDPKDKTLVEFLFNLYVQNGGKI
GTIGTTGDKDTRDTTPTVYSTAAGYIHEEAHIGDCKEQKKFCEKKNGAKPPSGDLEVDNE
YAFRDKPTDHDKVCDCESGEKLQNKKSEGIVLVEPCNVVNTLLKDKNENSDIDQCIRKYK
DGKEKYPGWDCTRNKIKIGEEGAYMPPRRQKLCVDFLKQLKDQTDEKLRDAFIKSAAAET
FLSWHKYKEDTQKEKATHTADNDLNKGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNV
ESKIEGVFSKADGTSSSNLSREVWWKKHGPKIWEGMLCGLSHAGGNDAIKSNQDYQYSEV
KIFKQSDGSGITLSQFAERPQFLRWITEWYDDYCHTRQKYLKDVKEKCKSNDQLKCDKEC
NNKCDEYKKYMEGKKKEWDAQYKYYKEQRNKKEVVNDSKGIIVKDYVLANAKEYLKKKFT
AICVTSSGKAQNSATEEVKKNIELLSEGQYYDAKEHCGCTKFIHDGKYSKISGRSNCYGL
NSDAKKNKIKWRNGDEKDYAFLKKRNLSGEVFFPSRRLGICFRGLDGYYRYPEVKDKDTL
RKTLMEVAATEGYNLGQYYKEKKKANKEAYRYSYEVRPYSAMKYSFYDLRDIILGYDNLE
DNSTTTEKNLKEIFKNESKEDSQGRQTFWNNNKDCVWEAMKCGYNKSGETIPDECKNMPR
DSDYPIGSNRDEGTEYQFLRWFAEWGEDFCKHKEKELKKLVGACNDYNCGDNEDKKKKCT
SACTQYKQFISEWKPQYENQIKKYGKHKHKIYSEHPVAKEAKDAQEYLDKQLQKSCNSGG
KCDCMNKKSMSNRNNMPASLDDTPSEYKKKCNCPLPHKKPEAPLARAAAPPASTKKKTPS
RKTQPSQPAREMQADEPASPSRRASLKEKAVASKKEEKTARPTKPPKKVEQPPTGIRAPT
RTPRAAPQARTRRSTPTTTASDVATMVKAILSNEPDSRGGIEGCNPKTYGQYPKWSCIVG
KSKENENGTCMPPRRKKLCINNIQYLNYETVNKREKDIKEAFIKCAAIETHFAWHRYKED
NKKAEDELKKGTIPDEFKRIMYYTYGDYKDMFFGTDIANDKKIITITNSVTTILNENNKK
KQDKKKDEELRKIFWEENKKFIWEGMIYGLTYHLKDENEKKKIKDNYQYNDMTKLTPSLE
EFVKRPQFLRWFTEWAEEFCNERKEQLKKLEAGCKEYECNGSDDGKTQECAEACVTYQAF
IKKWKTQYEVQREKFKKDKDNKKYKDYPSTERDIEKATYAHEYLNMKLKEFCGNKDCSCM
QKPSSQLPKTKSPLQPSNGNDMPESLDYHPEEFNKCECPEISKNESKTHTKKIPAPKIPM
NCVEKAAYYLSKEAENNIERTLKQKITHSNCVKETDNSFSSNNRCDPNKPYAPDKYIGRR
NPCGNREQNRFKLDSEWKCYKNIKLYQEKKRVCIPPRRENMCISNLDEIEIAKVNQSNYL
LNMVRIAARNEGIDIIKNFNSQNGCAMNPICDTMKYSFADLGDIVRGTDMLRIGGYLPPV
EIKLYKAFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWKAMTCKAPEDAKLFRK
GRMDGFESITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKALKVELEKLEKLEKSC
DHCKTTNKCKNDYDKNKCEKCKTRCQQYDNFILKWKTLFDIQSKKYKELYEPIDTKNSTY
DHVENFVQKLKKYKNECSVESVSEYLHETSKCLNYKFDENDGSSNIRSYAFEETPKSYKE
ACSCTLPSKNPLDNCPTDQNKDVCKELQTFTFCSKNDYDNNLDNWNAYLVLNSSDDNKGV
LIPPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKSEEELCFEAMKYS
YADYSDIIKGTDMMDTSLSEKIKKIFETSNQDTEDCKTWWEKNRSHVWHAMLCGYISKNK
NENINPKWCNVPTEDGTDQFLRWLIEWAMQACKEKKRVRDSLKTKCRCSNKDNFKASELL
RQPGCQNDIRKYISLNILIQNSMENLNIKYKKFKDQSSGLGFRV
Download sequence
Identical sequences W7JXY1
gi|124506557|ref|XP_001351876.1| gi|23504902|emb|CAD51686.1| PFE1640w 5833.PFE1640w-1 XP_001351876.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]