SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K0U4
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-17
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7K0U4
Sequence length 519
Comment (tr|W7K0U4|W7K0U4_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC90471.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_00634 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEVSTLIHRARIDSFDLKKRLF
YNILTLGGLGSHYGFQAATNVISGLNRTISSFTRDQGQSRDSNSPDQTTQRDDGDEPPLP
DGPPGKVPATDQITNALLGSAIPLGVGIAFASLAYLLLKVKPKITSTRTNLFRVIDIPQN
DYGIPHKTSINRYVPYSSNLYKEKTYIYIEGEETDDYSYVRVISSSDITSSSEGEYEEMD
INDIYPYKSPTYKTLIEVVLKPSIKNEEAHNTEDAQDILIENMEDTNDTPTNKLTDEEWN
KLRNDFISQYLKDLPNGMDYQLPNEYTVDDNIYMDIEPNILHDSMDEKPFITQIQDRDLH
NGKQITYDINWNIQKRNEKLLVILQMIRNIFQIMIYILE
Download sequence
Identical sequences W7K0U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]