SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K1T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K1T7
Domain Number 1 Region: 188-521,578-597
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-77
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 671-808,843-907,938-967,1028-1197
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.11e-70
Family Duffy binding domain 0.00083
Further Details:      
 
Domain Number 3 Region: 1187-1412
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-44
Family Duffy binding domain 0.0041
Further Details:      
 
Domain Number 4 Region: 1-70,103-123
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-18
Family Duffy binding domain 0.0068
Further Details:      
 
Weak hits

Sequence:  W7K1T7
Domain Number - Region: 1671-1700
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000889
Family Adhesin YadA, collagen-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7K1T7
Sequence length 1905
Comment (tr|W7K1T7|W7K1T7_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC87289.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_03912 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
WRDKLKKCIEDPEKKCKNGCNKKCECYERWVDKKKGEWKNIKDHFDKQPGFDQTFPPYYV
LEDVLEESYFPIIQEAYGDSTAIQGIKKTLEKKKKEKGANISEEKTILDEFLNHELKDAE
TCKNCEPRKFKNPCSGDTSGDSNKQYEAVANTVAQILQGKAQKQLHGNGSRNALKGNIQN
AKINNGRKPNPLTDACQITKNHSNGKGDSNNPCNNKGNRLKIGQVWSIKNDTSYTDVYMP
PRRQHMCTSNLEKLNYASVIGSNNVNDKFLVEVLHAAKSEAEFIKKKYNEKQNDGKNGLR
KDQATTCRAIRYSFADIGDIIRGKDLWDDNNDAKSLQTNLKAIFKKIKEKHPGIEGNDKY
VKDNENKQLRSDWWEANRRQVWNAMTCETPNGDNIKCDVHDVPVDDYIPQRLRWMTEWAE
WFCKAQSQEYDKLFMQCAKCMGNGQGCTKDSSDGECEKCKEACTSYANFINTWKPQWVPM
QIQYALLYSYVGKSGTIGLGGYPDYKQVVHFFEELQKEYENATRSSSTTKVSSTASPITP
YSSPEGYIHQELPITGCQKQKEFCYYKNGLTSRSSDAKENKNYAFKNPPHGYDLACTCNT
RDQQTDGRGRVAVNPDDNIITPGRIDNGEDDEESDEEDFEEEELENDDAGGGSDVGEEED
VSNHQEDKGPQKEDTPQIDVCAIVKTALTTPGNLTQACKQKYGPKAPTGWKCVPSGDSTT
TGEARARRVARSAEPRGSEPTSDKGSICVPPRRRKLYLGGFKRLTDGTAVSSETTSATSS
HASNGDALLTAFVESASVETFFAWHKYKMEKKQPAQEGAGLGLSLLEQEVSPEDDPEKQL
QTGTIPPDFLRLMFYTLGDYRDILDGKNMEVVNLLKDGSPSDKEMYTRENKINQAIDNHF
SKNENQATTGVNQSSSGGVPSSSGHSSSSTVTPPGPPQTSGTTPKTWWQKNGEHIWNGMI
CALTYEDNGAKGTSNALQQNEEVKKALWDETTKKPKDEKYQYDQVKLDENSVTDGPRTTS
PGTSGDTPPTLSQFISRPPYFRYLEEWGETFCRQRTRMLKNVKDNCTKDDKQKYSGDGEE
CEKVLVEEANTFKDLEGRSCADSCRSYKKWIGRKKDEYDEQESAYGQQQKEYVNGSKGAG
RNNDDKEFCTKLEKTWTTAGDFLKSLGPCKNNDNGEGTIKFNGGQTFQHTNLCDSCSEFK
IKCENGVCSGDTKVECNGKTPIAATEIAKMITSTEGVFMTVSDNSDHKFDDGLKDCQHAG
IFKGIRKDVWTCGNVCGYVVCKPKEGNRETASGENKDQIITIRALVTHWVQNFLEDYKKI
KHKFLNCTKNGQSKCINGCNNKCTCVETWISTKKGEWKNIKERFIEQYKGEPSDEYFNVR
SCLETFIPQIPVADVKNEVIKLSQFDNSCGCSFSAHKQKDSNQDSIECMIKNLEKKIDEC
KTQHYPSGKPEEQCKEPPPEDDYEDENEKKVESPTICPKETVDQKTKVEDEKCDKTRPVV
PKEDRQEEEESKKKKDETALPPPEPPADSPPPAAPTKPLPSDNTSDILKTTIPFGIALAL
TSIALLFLKKKTKSSVGNLFQILQIPKSDYDIPTPKSSNRYIPYVSDTYKGKTYIYMEGD
SSGEEKYAFMSDTTDVTSSESEYEELDINEIYPYQSPKYKTLIEVVLEPSGKNTTASGNN
TTASGNNTTASGNNTTASDTQNDIQNDGIPSDTPNTPSDIPKTPSDTPPPITDDEWNQLK
HDFISNMLQNTQNTEPNMLGYNVDNNTHPTPSRHTLDQKPFITSIHDRNLYTGEEYNYNV
NMSTNSMDDTKYVSNNVYSGIDLINDSLNSGNQPIDIYDELLKRKENELFGTNHPKHTNT
HNVTKSSNSDPIDNQLDLFHTWLDRHRDMCEKLKNDNERLAKLKE
Download sequence
Identical sequences W7K1T7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]