SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K5I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K5I1
Domain Number 1 Region: 411-728
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-48
Family Duffy binding domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 128-402
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.26e-47
Family Duffy binding domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7K5I1
Sequence length 1516
Comment (tr|W7K5I1|W7K5I1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC79306.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_00018 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSILYVVLCTYVLGISEEYLKERPQGLNVETNNNNNNNNNNNNSNSND
AMSFVNEVIRFIENEKDDKEDKKVKIISRPVENTLHRYPVSSFLNIKKYGRKGEYLNRNS
FVQRSYIRGCKGKRSTHTWICENKGNNNICIPDRRVQLCITALQDLKNSGSETTDRKLLR
DKVFDSAMYETDLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKLVEESLK
RFFKKDSSVLNPTAWWRRYGTRLWKTMIQPYAHLGCRKPDENEPQINRWILEWGKYNCRL
MKEKEKLLTGECSVNRKKSDCSTGCNNECYTYRSLINRQRYEVSILGKKYIKVVRYTIFR
RKIVQPDNALDFLKLNCSECKDIDFKPFFEFEYGKYEEKCMCQSYIDLKIQFKNNDICSF
NAQTDTVSSDKRFCLEKKEFKPWQCDKNSFETVHHKGVCVSPRRQGFCLGNLNYLLNDDI
YNVHNSQLLIEIIMASKQEGKLLWKKHGTILDNQNACKYINDSYVDYKDIVIGNDLWNDN
NSIKVQNNLNLIFERNFGYKVGRNKLFKTIKELKNVWWILNRNKVWESMRCGIDEVDQRR
KTCERIDELENMPQFFRWFSQWAHFFCKEKEYWELKLKDKCTGNNGKSLCQDKTCQNVCT
NMNYWTYTRKLAYEIQSVKYDKDRKLFSLAKDKNVTTFLKENAKNCSNIDFTKIFDQLDK
LFKERCSCMDTQVLEVKNKEMLSIDSNSEDATDISEKNGEEELYVNHNSVSVASGNKEIE
KSKDEKQPEKEAKQTNGTLTVRTDKDSDRNKGKDTATDTKNSPENLKVQEHGTNGETIKE
EPPKLPESSETLQSQEQLEAEAQKQKQEEEPKKKQEEEPKKKQEEEPKKKQEEEPKKKQE
EEQKREQEQKQEQEEEEQKQEEEQQIQDQSQSGLDQSSKVGVASEQNEISSGQEQNVKSS
SPEVVPQETTSENGSSQDTKISSTEPNENSVVDRATDSMNLDPEKVHNENMSDPNTNTEP
DASLKDDKKEVDDAKKELQSTVSRIESNEQDVQSTPPEDTPTVEGKVGDKAEMLTSPHAT
DNSESESGLNPTDDIKTTDGVVKEQEILGGGESATETSKSNLEKPKDVEPSHEISEPVLS
GTTGKEESELLKSKSIETKGETDPRSNDQEDATDDVVENSRDDNNSLSNSVDNQSNVLNR
EDPIASETEVVSEPEDSSRIITTEVPSTTVKPPDEKRSEEVGEKEAKEIKVEPVVPRAIG
EPMENSVSVQSPPNVEDVEKETLISENNGLHNDTHRGNISEKDLIDIHLLRNEAGSTILD
DSRRNGEMTEGSESDVGELQEHNFSTQQKDEKDFDQIASDREKEEIQKLLNIGHEEDEDV
LKMDRTKDSMSDGVNSHLYYNNLSSEEKMEQYNNRDASKDREEILNRSNTNTCSNEHSLK
YCQYMERNKDLLETCSEDKRLHLCCEISDYCLKFFNPKSIEYFDCTQKEFDDPTYNCFRK
QRFTSMSCYKIKNNIH
Download sequence
Identical sequences W7K5I1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]