SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K7N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K7N9
Domain Number 1 Region: 174-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-26
Family Thioltransferase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7K7N9
Sequence length 272
Comment (tr|W7K7N9|W7K7N9_PLAFO) Grx4 family monothiol glutaredoxin {ECO:0000313|EMBL:EWC89514.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=CK202_5464 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNKYIRAPNLIYICASLGIHSILFKKQKSPDNKNSYHIKDFIKLKNIIFLTSCEVTQDPK
EGGGKKNYDRYHNELFNNKINQNKVHIDNNELVNYFDELYEQSKNENIITKGEGEEVEFN
SSNLLLPFVEEHEHVKDKNDNDKCIKYEYVNDKCIKDEHGEFERVEENIKLSEDIINIIE
NILKKYNVVLFMKGTALNPYCKYSKQAIHILKLNKVKQIHTVNILDNQELRNALKIYSNW
PTFPQLYVNQKFIGGIDKLQELHDQNKIKDII
Download sequence
Identical sequences Q8IBZ7 W7K7N9
PF07_0036 gi|124511746|ref|XP_001349006.1| gi|23498774|emb|CAD50844.1| XP_001349006.1.26446 5833.PF07_0036-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]