SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K7R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K7R2
Domain Number 1 Region: 95-468,502-522
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.18e-78
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 513-759
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-34
Family Duffy binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7K7R2
Sequence length 812
Comment (tr|W7K7R2|W7K7R2_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC89549.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_01764 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGGRQGDGGEDIDHQSAKHLLDSIGKIVHDQMKKEAEQRSKGELEGKLSFATVSGETG
ATDKPCNFDYDKLIGANDGKRHPCKKDGKGEEVPRFSDKQGAECANNRIQGNNKNSHYKD
FGACAPFRRLNLCNKNFPNMNSNDSSKAKHDLLVDVCLAAKYEGDSLKHYSEKLNLTYTD
SPSQLCTELARSFADIGDIIRGKDLYLGYNRKEKAQKEKLEQNLKKFFQNIDEKLPLKAK
NYYTKEKDPNFLKLREDWWTANRETVWEALTCDAHGTYFHATCSDLNGDCSQAHEKCRCP
KTSGGKAIKAGGDVTIVPTYFDYVPQYLRWFEEWAEDFCRKKKKYVDIVKTYCREQDKSG
NQRYCSRNGYDCTKTVRARGKYRMGNQCTKCLFACNPYVEWIENQRKQFDKQVKKYKTEI
SDGGGRQKRDAGGTTKYEGYEKKFYDELKGNYSDVNAFLGLLNNEKACTAVKDNDGGTIH
FETVGTTTTIGENGGTSDTSGTNNENEGTFYRSKYCQPCPHCGVKREGNEWKEKKKNTDQ
CTSGKRYKPKNNAEATNIRILKSGDGQTEIENKLNEFCDQINLDTLNSGVNSAGGGGGGR
SGSQELYQEWKCYKGDDVVKVENKDEEEDEEENVQKVKDAGGLCILKNERSETNSQNHPY
DIQKTYNDFFNFWVAHVLKDSIHWRTKKIKGCLSNGAKIRCNKKNKCNNDCGCFERWVKQ
KKDEWKPIKQHFYTQEDIVKKGPFMTLTHDYVLEGVLELEFLKGDSEEDFEADSSEDSQS
RDEDAQETKRIKDMFEKKKKKIKMRLLPMRKQ
Download sequence
Identical sequences W7K7R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]