SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7K993 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7K993
Domain Number 1 Region: 43-465
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-85
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1197-1535,1570-1588
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-77
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 3 Region: 2553-2606,2638-2663,2718-2740,2775-2867,2921-2970,2993-3100
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-76
Family Duffy binding domain 0.00063
Further Details:      
 
Domain Number 4 Region: 794-1131,1174-1192
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.27e-74
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 5 Region: 492-712
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-34
Family Duffy binding domain 0.0029
Further Details:      
 
Domain Number 6 Region: 2195-2414
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.24e-34
Family Duffy binding domain 0.0063
Further Details:      
 
Domain Number 7 Region: 3102-3317
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-31
Family Duffy binding domain 0.0066
Further Details:      
 
Domain Number 8 Region: 1690-1866,2034-2106,2138-2155,2183-2202
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000000000147
Family Duffy binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7K993
Sequence length 3964
Comment (tr|W7K993|W7K993_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC89545.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_01760 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAAAGSGGQGARDVLEQFGEIVQKKVHNEVDAYREELKGKLWEAKFVGVSHVPSDPCQLN
HEYHTNVTTGKDDPCDRRWPVRFSDESRSQCTKNRIKDSTSDTVGACAPYRRLHVCDQNL
EQIRPEQITSTDNLLADVCLAAKHEGESIIKNYPQDRNNNEVICTALARSFADIGDIIRG
KDLYRGDKGEKKKLEENLKNIFANIYEELKNGKTNGKKGEIETRYKKDDEDGNFFQLRED
WWNANRNDIWKALTCHAPPDAQYTKKGPHNHITESNKGQCRCFSGDPPTNMDYVPQYLRW
FEEWAEEFCRKRKKKLQNAQKFCRDESSKLYCSLNGYDCKATIRANDEYTISQACAKCFF
SCHRFVKWIDNQKLELEKQKKKYDEEINVTTETSKKTEHGRINIIYAKKFYDILKEQYGK
VDNFLELLSNQKECKNHPEVKGKNSIDFKNDNDTFSRTEICEPCPWCGVKKQEDGNWKRL
ERGHPHCPKKPPYTPPDGAKCTEIDVLYTGERNNDILDKLKEFCRSEGKNERKTDFKNEQ
WKCYYKDSYNNKCVLQPDRDLGIEKKVKNYVDFMMFWINHMLKDSIDWRKYIKRCINNSA
SNECKKNMCFKNCQCFEKWINKKQDEWNKIKKHYNNEKGFGEFGSYNTLEYILEEDFFKG
ISEAYGSVDAIERIKNITKNHVSTEEITNAENEEFAIDILLKHELEEAQECKNNNPEDQK
CNEPHDEEEYEDEHEEEVYVNNPCAKPSGNYPALAHNVAYQMHEVAKTQLRTRGGRNALR
ANAAEGKYKNNNKEFTFNGNICSINENHSNCNHNYSSGPCGGKDGRNEMFEVKDGWKSGA
DVSKEHAEDVFLPPRRQHFCTSNLENLNTNSKGLSDGTLASHSLLGDVLLSANKEAGFIK
DKYKNQPTLGGFKDEATICRAMKYSFADIGDIIKGTDLWDGNKEETDTQRNLVTIFGKIK
DKIRDEATKKKYSDAQKHLQLRKDWWEANRDQVWKAMQCGNDNPCSGVSGVPLDDYIPQR
LRWMTEWAEWFCKMQSQEYNKLMEACTGCMKKGKDGEGCTQKTQECALCKAACDAYKKEI
EKWQRQWNNMQVPYITLYEQARTVRDGTVIGDVSDQQVIAFFKELHQQNGGKKSVDTVYS
TAAGYVHQEAIMNCEKQTQFCKNKNGENSISGTQNNQKYAFMQPPKGYEKACSCEDYYKA
ADPQDDACTIVKQLLGNKGAADDIQGCKKKYDGINPYPSWKCDKSLVDEDGVCMPPRRQN
LCVHYLTQLDDKDDENKLREAFIKSAAAETFVLWQNYNSKNDNDAQLLDSGIIPPEFLRS
MFYTFGDYRDICLDTDISAKTPDGDLEQAKENIGKVFQKIGPKTANHKPPRGITREDWWK
EYGSQIWKGMLCALSYDNETRIMNERVRKQLMDSIYNYHILKNHLENFAERHPFFRWFIE
WTDEFCQEQKKEYNDLVQKCTGCNEQTCDSECETCKSQCGQYEKFITQWKSQWEKQSGKY
DKLYAEAKVTSTPTTDPIETKLLKHLKELKDHSTNSDKYSTAGRYMKEEGYINDCELSKQ
NKFEKNCNDGSNDNYAFRTYPNDHQTKCDCKKKEAPPPEPPANVVPKVIPKSRTPREAGS
SHLQNALLSSTIMWSIGIGFAAFTYFFLKDAKHVLDEFGQQVHKEVKKEAERRSKGELKG
LLTSAKLSGGEIAGTTDPCSSDYTKHFEANSNRYPCGNTNVDRFPDNDGAECDNSKIKGN
KGKEDNSEGACAPYRRLSLCNKNFQNNNNDHSSNAKHDLLLDVCMAANYEAQRYRTRQRF
ISWKKKKKKTETERERDQLEQKLKGIFKKIYEGLTGGVKDHYQDTDNYYELREDCGDIPF
NTQPNTLYFDKPEEKPFIMSIHDRDLYSGEEYNYNVNMSTNSMDDIPINSHNNVYSGIDL
INDTLSGNKHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKLTNSDPIHNQLELFHKWLD
RHRNMCEKWENHHERLAKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIHMDDPKPINQF
TNMDTILEDLEKYNEPYYDVQDDIYYDVNDHDTSTADSNAMDVPNNQRKQFLKQRNKYAD
EIKIYTEGASGGSRQRRNVRSNYDNGYEKKFYKELKNRYGSVETFLVLLNNEKACTAVDD
DKGGKIDFKEVNTGGAASGGTSGTNVESQGTFYRSKYCQPCPLCGVERKGGSGWEEKDKI
EKCKSINLYKPRDDKVGTTIKILKSGEEEKDIETKLKAFCDNKDSGNSDPSLYDPWQCYQ
IGELTKDQKEGGEDDLDYEADVQTGGGLCILKKEKKTDNDPDEIQKTFNNFFYYWVAHML
KDSIYWRMKKLERCLQNGNKKCGNQKCEKPCDCFQRWVQQKETEWGKIKTHFNTQNIGAL
TGCNPIVTLEGVLKLQFLKDESTEDSEENSKNSLDSEELKHLKHLSEMLQGTGVDGLTCS
DSGTEQKTLMDKLIDYEEGIATECKKCDEPKPEGAAGGRSDGPPGSPPRPAEKDEDHHSD
ESDEEEDEEHTEQGEEKTEGKTEEQPEEVKEHTETPEDEVNPCKIVETLFTSDDNNALNE
ACKQKYQYGKEKFPNWKCIPSGDNSTTSSEGGDRGGQSRAKRAAPRESTTSSGDTTGGSI
CVPPRRRKLYIKKIVDWAESQSKTLTSVNGDGNGSQEVVSVNGASESGSQGSRSDSSSSS
SSDSSQGTTSATSQSPNGDLLTAFVESAAIETFFLWDRYKKIKDIEEKEIKEKNEIYGIY
TSSVDEKPQNKLNGGDIPNDFLRLMFYTLGDYRDICIGVKEDVIKALEASSDKNIETIKK
AIDEILSKQSRNNQQSGQKSENPRDTWWKTNGEHIWNAMVCALTYNEDTSGAKGKQPQQD
QSLKDKLIDKKTGKPEGKYHYEKVTLENSDTQAISNDTINNPKLKDFVEIPPFFRWLHEW
GSDFCGKRARMLKNVKHNCRNIDNPGHQYCSGDGYDCEKIKPENYKNISDLDCRDCYKQC
RKYRKWIEKKVEEFHKQEKKYKGEHGKLRNDNCSGNDNKEYCEQIKQKTSAADFLAALKH
CKNDQIDGEQGNQEDKKNNEIKFEEPLKTFGPLEYCKTCPFNGVNCTVRRGTNGCIENGQ
IWKKVFEGISGNGENSTITVDMIDRRGPFIEKYLGDSNDLFKTSKLFKGIRKQNWTCKFN
KDKNMDVCHLTNFKDNIDLNEYTTFKVLLIYWLEDFLYGYYLLKKKKKIYLCTQNKEQTC
SEESKNDCACVKEWIGKKRAEWKTIRDRFNDQYKSENSGDTFPVRSFLEGLIPQIPVADV
QGNVIKLSKFGNSCGCSFSAHSTNGKDDAIDCMIKKLEEKVTSCLSSTSGDNLAQCENST
PLEDDDEPFEEEENPENMRPGFCPPPEEKTEIEGTDKKCEEAPTTPPEPAPPAKSGEGTE
ELPSAPEPPQDKALPKPAAQPKDKKRPKRQPQNPWEHPIVIPSLATSTLMWTVGIGFATF
TYFFLKKKTKSSVGNLFQILQIPKGDYDIPTLKSSNRYIPYASERYKGKTYIYMEGDSSG
DEKYAFMSDTTDVTSSESEYEEMDINDIYAPRAPKYKTLIEVILEPSKRDTQNDIPSGDI
NSDIPNTPSDTPSPITDEEWNTLKDDFISNMLQNEQEDIPQPDVSKELPLNTHPTPSHDT
LDQKPFIMSIHDRNLLNGEEYSYDIINNIGNNDLYSGFDPKSGDNVSYSGTIGSISDKTS
PYSGIDLINDSLNSGNHIDIYDEILKRKENELFGTNHVKHISTHSVAKLTNSDPIECQLN
LFHKWLDRHRDMCEKFSNNKEELLDKLKEQWENKTHSGNKHSDIPSGKLSDTPSDNNIHS
DIHPSDIPSGKQSDIPSDNNIHSDIPYVLNSDVSIQIDMDNPNQVDDNTYLDTYPDKSTM
DTIMDDLEKYNEPYYDIYYDVNDHDASNVDSNNMDVPSKVKIEMSVKNTQMMEGKYPIGD
VWDI
Download sequence
Identical sequences W7K993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]