SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7KBI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7KBI7
Domain Number 1 Region: 480-781
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 204-449
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-40
Family Duffy binding domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7KBI7
Sequence length 1388
Comment (tr|W7KBI7|W7KBI7_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC90390.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_00785 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDN
KKEALLEDKKNVDNKDIKEQLPENNKNFEEKILHEDICKLNKENIEKEGLYKPNTFKSIG
NDLLYKKGKLNFLYEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDISNNNMNSLNSMNN
LNNSNNFDSSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGN
LIELPINDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTD
MEGLGRSIKVEFEIDRIFKRDNKKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECS
ADKPLDEPQINRWLMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKKRNFSLYKTAFEYLK
QKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENNALYVKIEDICNNTKVKSIYGELYC
KEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEFKNVNDLKKFLNEIILGIRD
EGKFLIEKYRKNMHENMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGNF
EGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDNQ
YLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWII
NKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDIC
KSTVKPYDPEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPKG
GTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGRDVSSSPV
GVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEERSI
ITSDVEHGTNSLFGSQIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASVD
SSSEMSNGGRGGLKTKEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHIN
VLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNRIETTAENNIGGLSNSNVHDG
RDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEEDANTLKYPRNVLNNKNSRT
YNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLSNTCTNEDSKRLCCSI
SDYCMKFFNFNSSGYHSCMRKEFSNHAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKSS
ILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFEDYDENAYRIGLLMNQKIQSAKSSD
YLEYHVDN
Download sequence
Identical sequences W7KBI7
XP_001351546.1.26446 5833.PFD1155w-1 gi|124505609|ref|XP_001351546.1| gi|23498305|emb|CAD49277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]