SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7KCU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7KCU5
Domain Number 1 Region: 270-286,346-408,449-549,602-780
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-77
Family Duffy binding domain 0.00076
Further Details:      
 
Domain Number 2 Region: 816-1034
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-31
Family Duffy binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 2-85,131-151
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-21
Family Duffy binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7KCU5
Sequence length 1225
Comment (tr|W7KCU5|W7KCU5_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC87412.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_03790 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
RFLNDSMYWRGKVNSCINKSKREKCEEECKKECECFQKWIGKKKEEWDKIKEHFKTQDFG
NDALLGPEMKSPSYVLKFVLNIDELFQNIKSGYGNVKELKGINKILDEEKKREEEERADG
VVGVASGGDNQNNTTIDKLLDHEDKDATKCKNCQEPTKPASKPEDLARSGASPDTPREDS
PPADLDDEEHDEDDEDEDDDAEEEEEEEKKEEEEEHKEEENEAAPEEKKEEGSSSPEEVE
EKAKEAPAGPDACNIVQTLFSSIDKFSDACTLKYGKTAPTGWKCVTPSGDKAATSSEGKG
SSDGGAKDGVGVNGGALQRNKRDLATPSAKSGDTTGGKDGATGKSDGSICVPPRRRRLYI
QKLHDWAEKVGDTATQPQVDTPSQSDKLRDAFIESAAVETFFLWHRYKKIKDKEKLEEQQ
RQRENGELPGLSSSGDGDSNDPQSKLEKGEIPDGFLRQMFYTLADYKDILYSGSNDNTKS
STYNDIINGDKEIQEREKDIKGAISTYFSNSGTTPTPPVKPSVTTPQTWWELHGPHIWNG
MICALTYKENGIDKPEVDTAVRAQLWDSGKNTPQNEKYQYTNVKLEEEASGAKINIPDTS
GDNTPTLNTPTLKNFVEIPTFFRWLHEWGSDFCRQRKRMLKNVKHNCRNIERGGHEYCGG
DGHDCTRDGIQHNNMLADPDCRDCHIQCRKYRKWIEKKFEEFHNQKNTYGKEKQKLNGNS
NDGDNTKFFKEIENRSFDQFLTSLKHCKNNEGDGSDPKNKIDFKEPLKTFGPLEYCKTCP
PNKVNCNGPSRRSGGNDQCTAVNGNEWEKIFSENGGNSTTIDVHMIDRRGPYMEKKSQKL
ENSENPLFKTSRLFKGIREQKWTCKFKDKNTDVCKLDKFDQEVDLNQYTTFKVLLIYWLE
DFIEGYYLLKKRKIIEKCTQKGEKTCDDESKNDCACVKKWVEKKTTEWEQIKEHFKNRNQ
KDGDGNDMKSSVRQLLDPLIYRMDLANGKGKINELKEFLKSYECKCVDNAGNSEKDVVEC
LLQKLETKAKKCKDPSSGENQKTPCQEYTPPDDDEDLLLEEENTVKAPTFCPKPPKKEEQ
TEETCDKAADEKVEETVAQNEENNIPPAGPAPPADSPPAGPATDSGKENVVPEPPAPAAP
PSPPIPPLATSTLAWSVGIGFAAFTYFYLKVLYIYMYMWGCCVFVWIYIYVYVFSVYVSV
SMFGYIYGFTCMCFIYILYIFMYLY
Download sequence
Identical sequences W7KCU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]