SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W8BSD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W8BSD7
Domain Number 1 Region: 349-622
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-46
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 229-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000181
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 73-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 161-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 123-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 6 Region: 36-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W8BSD7
Sequence length 635
Comment (tr|W8BSD7|W8BSD7_CERCA) Prostasin {ECO:0000313|EMBL:JAB99818.1} OX=7213 OS=Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata). GN=PRSS8 OC=Tephritoidea; Tephritidae; Ceratitis; Ceratitis.
Sequence
MLEFVIADFSYSTLINIYIIIIFGLITGRSLQQKECDWRCDDGECIDSEYLCDGMINCAD
GSDETIENCYGNSKCPTYAFRCAYGACIPGIKRCNNKQDCADNSDELKSICRMTVSEVEA
AVRGSCGDAEMQCDSGECIDSDKVCDGIRHCPQGEDETLDKCAPFSCQSFAHRCAYGACI
EGKAACNGTVECHDGSDESYALCGGTRKSSSTPPTRITTVPTIPSIEEFCKIPKNLPNVI
ITHGYLGTHLAMGTTVPTNTFVRFSCQSGYILDGKSYSLCKSDGWDSELPICTNSKYCNS
NEIREGVSTIARCFYQKSEVPCEKILPGTTAEINCAIGYTRKHVTNTELHCTNDYKWDQE
RAPCELKCGYVQQKSISLAKYGTEINVTEAPWHVGIYSNLNERDFKRSCGGSIVSTRLVV
SAAHCFWDDAVEAVYDKRLFKVSPARSASESISNEGYNVASIYVPSKYKSFNENYDGDMA
IIKVAKPFIFSAYVRSICFRYQQQAAATVENGLNGYIVGWGITANSSNIDVFQKISVSTV
SYYNCIEKLKINETHNYDLPTDKFCAIRSSSTGDICQGDSGSGFVRYIDGRYHLIGVISH
APWSQSRCALESLITLTNVQYYEEIQQNILNDEEQ
Download sequence
Identical sequences W8BSD7
XP_012158637.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]