SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W9RFC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9RFC9
Domain Number 1 Region: 420-503
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.15e-16
Family UBX domain 0.02
Further Details:      
 
Domain Number 2 Region: 169-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000626
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W9RFC9
Sequence length 633
Comment (tr|W9RFC9|W9RFC9_9ROSA) UBX domain-containing protein 4 {ECO:0000313|EMBL:EXB68696.1} KW=Complete proteome; Reference proteome OX=981085 OS=Morus notabilis. GN=L484_024712 OC=Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus.
Sequence
MEYIGLQQGDMSVREYEAKFNELSRFAPFLVESEHMKCLKFEKGLKSAIWRSLVALRLRV
YRDLVAAASALNRSILPTFRIHTLLSALVAYPDVNSFYTDLSPAELHLFSPQASGSVQSP
PPLQQYRLGNQRPYNNGRGKGGRRQEEKEGWRWEEEKREKERVNAESSRLDSSTWSDSKV
AESVLKYCILLHLSEGSNDATQFSAIYPQKSIPCITAVGYNGVQLWQNEGFISAEVLASS
LEKVWLSLHIQDTTAAVLSAALASKTSEPSSSGVSTTASSDQGSSDVGGQSPLTDRYGKS
PDAITEVSPDKVKEHKSDACTAEEKSFECGVKTSSTSVDANEAGCASTDFSIEATKELPR
STVVDLDNVALLDGPHSPEKNSTDSNLVVSGGGSKTMNTEVNQVERGANNEDEADKRVNR
VNKSNDVYLNIRMPDGVNLQEKFSVTSTLRMVKDYIDEHHEGVIGSYDLAIPYPRNVYSD
QDLSRTLSELGLFDRQALIVVPRQRTTDQSNSRNIADSSNESNEGYFARLKRLFSFINPL
SYLGGDGSSSTSSGQQSQHGPNSTLQNNFTQEQRPQNISSSSGNDGKNRRPTASHFGSNI
HTLKHDEDDGRFNDRNSFWNGNSTQYGGNDDGK
Download sequence
Identical sequences W9RFC9
XP_010097505.1.32101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]