SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1JV66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X1JV66
Domain Number 1 Region: 91-185
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000811
Family Pseudo ankyrin repeat 0.0065
Further Details:      
 
Domain Number 2 Region: 16-85
Classification Level Classification E-value
Superfamily F-box domain 0.0000218
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X1JV66
Sequence length 192
Comment (tr|X1JV66|X1JV66_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAH73688.1} OX=412755 OS=marine sediment metagenome. GN=S03H2_41911 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MIDIKGLSGNLDVDKQILAQLNDRDLVNICKSNKYLNSICQSNDFWRIRSLILIKDTIPY
KTEKSLTFTEKSLTFTEKSWKQHYIDFSIKITENELIKNAKNGKINVIRYLIDKKIDPSA
NNNEAIILASKYGRLNVVKYLMSQYPKYNIDPTASDNDAFSFASSNGHLEVVKYLMSLTD
VNGENIINPADR
Download sequence
Identical sequences X1JV66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]