SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1TGN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X1TGN8
Domain Number 1 Region: 60-137
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000183
Family Carboxypeptidase regulatory domain 0.011
Further Details:      
 
Domain Number 2 Region: 145-198
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000000106
Family Cna protein B-type domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X1TGN8
Sequence length 202
Comment (tr|X1TGN8|X1TGN8_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAJ04453.1} OX=412755 OS=marine sediment metagenome. GN=S12H4_50244 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MPEEIKLLPAGKREAEKGRVPVGVIVGLGAAGATAIGLGLWLLTRRPKEPEPPEPGMANL
YGTVINTQTKKGIPGAMVTLADATVYTDSSGAYIHEDLTPDNYTITIDAEGYESKHFSVY
LAEGNNELDVELIPAGLEAEFHCGVWDSLTHEPVANALVRLDGPETREQRSNEWGDASFY
DLPAGDYTVTISMADYQTLLEA
Download sequence
Identical sequences X1TGN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]