SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X2JA03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X2JA03
Domain Number - Region: 151-176
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0432
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X2JA03
Sequence length 513
Comment (tr|X2JA03|X2JA03_DROME) CG4709, isoform B {ECO:0000313|EMBL:AHN54302.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4709 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEEYEAQLLVVEQALENAADDAQRQDLLALKNNLQELLALTRESGDEAPIDELPQQGDNL
DDELQRLKSELNDLEAAGSSQTALDEERQLADLRTKYTAMVGEKCSAPHEHSWGTCYHNA
LICGVDDEVVMNSEGVLDARLRVLFTNPTHREMLPCSYYLEGECRFDEAKCRFSHGALVT
GSSIRKYNPPDFHKLSRSRPVFALLPDRLWHRGRVLCVNFVEQICRVRLDGQDHKERERD
FKFEELYPLTTDQDEDDELSSEESNSSMNDNSSDEAESDMDDLEEARRARMVELSLFTFK
PTERLGAWEEFTRGIGSKLMEKMGYIHGTGLGSDGRGIVTPVSAQILPQGRSLDACMELR
EAANGDKDYFSVERKLKRAQRRQRKADEKAYVRESQRVDVFTFLNDSVLGPGESTQQGEQ
VTKKAKTNELQQHSTKTLNVETVRIADEIRRKQRDMAKVKQSLDRNSGDAQLQKRLQVQM
QSHKQELATLQAQERSLSKEQQTRKSKNKMFEF
Download sequence
Identical sequences Q9VL59 X2JA03
FBpp0079480 NP_001285788.1.81976 NP_609331.1.81976 FBpp0079480 FBpp0079480 7227.FBpp0079480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]