SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|164225|CE76440_5048 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dekbr2|164225|CE76440_5048
Domain Number - Region: 549-602
Classification Level Classification E-value
Superfamily PH domain-like 0.000334
Family Pleckstrin-homology domain (PH domain) 0.083
Further Details:      
 
Domain Number - Region: 632-699,732-799
Classification Level Classification E-value
Superfamily PH domain-like 0.0283
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|164225|CE76440_5048
Sequence length 802
Sequence
MCYKMKNLIPIELPSNSLTAYKLRHCTVQQIHRNMSTEFIGPLPIQWILLKEAQISQRNC
ENNYKYLGKSEDCKQNGTRFWKDDSNKDQESYTKVSRKEKHNAKERQNAIIANRSMITVK
ENVKGQERILLRWQECFVLMKLFHSNESAVLQIYKLTPKLDRSINQSEYTFLSDSFEKPL
FSLEISERNIKLELSDAERIIFIKQYIQEGNTCLLFTLLPDTLNTTTTWICQLRKIINQH
KAIQKTITLLIKPLELSITSQYPHNKSAGYENNCMTIYYVPNGYMVKYNSESRYILSEMK
KRIKNLCSLRKDRLNQETITFIQRLLKKEEEFLKYFKIIDINGYILTEANLNAFDMSNEF
LGNKLLILCEFPTEVSESNKNQFQGCQPYSIEGFLLRSKDSRRGCHYKIEYVYTIQSFLF
FQPYQYADPLLSKDNFKLKSPSFSLSEFRTQVETRDSTFSFSPYPIDEYHIKWLHPGLPV
SEFERLDKIANKEAERKANLLLNAFYFIDVCDIKDITPLHKQLISSRLAKTKNIVWIPPE
NGNNLLLLRDTDFEIRMKNGTSVMLSASCREIRDIWIDRLQQTCRYWRQKKIHDIERIQR
ESIRQMSKEYTKEKEKSKIIQTRPITIPENVDSPIVKVDTIYYKGKKTSPFKKVTLLLSY
ASLILFDCESSIHFGNVKSPLPYSKKILDIYLSHSYVCEGDQYSSYSHSNNARISKQYLE
DTSVPKVYFYGIRNSDDHNKRSFTIWYNNNVSNSWAPGFSDFKNLNGRPVKQVEDHAIFL
TKSADDKLNWIKNIQYIMNFCH
Download sequence
Identical sequences jgi|Dekbr2|164225|CE76440_5048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]