SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|182484|CE94699_20385 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|182484|CE94699_20385
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-20
Family TFIIH domain 0.00048
Further Details:      
 
Domain Number 2 Region: 154-198
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000000111
Family BSD domain 0.0046
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|182484|CE94699_20385
Domain Number - Region: 225-269
Classification Level Classification E-value
Superfamily BSD domain-like 0.000222
Family BSD domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|182484|CE94699_20385
Sequence length 651
Sequence
MPATVSGTAFHHRKAGIVTILEDAEPPKVVWKCVDTDASHSVVSIPLDKIVSLQATPAKI
QKMMSKIGLKDEHGSESDGKRQKKHKNSVIFSFNNRVTMDNIKSTLQQVIARKKTSKEME
ASRSETPDNEFGTSEYGENVDNDELLTNSLDSKKLLKNFTLQQKLLRENSDLMKTFTEAV
IKSGLEPEEFWSSRIHLLRSYAVQHSQKRGPYNVLSTIKPVASSENEVNVSVTREKIHEI
FKQYPIVRKAYDDNVPKISEGEFWSRFFSSKLFRKLRGEKINLYDRGDITLDKYLYYDPD
YDGEEEDEDVDKLLEDQEAKETDRHKEKGRSKKRRASDLQITAAKKKVKLFNGEDEKISK
CIDILGNEADDAGLLGNKPDITMKKDQDPDLVNIMRTMNRLSRRMMSNIKENPRKKNANP
DDEFKHELEIKDLDHKETVDYNKLNYTQRSNVSSSIVPPELVKQAMTQSDLNPKLNDYDA
SMQMFKDQFNEAEKLDLTSVYFQIKKSIYDSYKDVISIVRKNSKQSSQSWSLDNDNLSTG
WKDARSEISKDRLESLRLTQSTSIEFLRHFWIHFNSISTSSISTNSHFKKESIQSRKSFF
SITKCLERVTANSNQSEGEERTKEEEIMHPLIESLKRALQKYEDAIIEPKR
Download sequence
Identical sequences jgi|Dekbr2|182484|CE94699_20385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]