SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|20711|fgenesh1_pg.3_#_709 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|20711|fgenesh1_pg.3_#_709
Domain Number 1 Region: 404-472
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000068
Family Vacuolar sorting protein domain 0.0096
Further Details:      
 
Domain Number 2 Region: 446-569
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000748
Family Vacuolar sorting protein domain 0.021
Further Details:      
 
Domain Number 3 Region: 82-129
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000306
Family Ran binding protein zinc finger-like 0.0055
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|20711|fgenesh1_pg.3_#_709
Domain Number - Region: 158-180
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000102
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Domain Number - Region: 156-250
Classification Level Classification E-value
Superfamily PH domain-like 0.00959
Family VPS36 N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|20711|fgenesh1_pg.3_#_709
Sequence length 627
Sequence
MVSNSHKIVAIALRLSVISRCIFHPGFLTSSPKVEIVLRSSGVTHPSNKFSDQSKISDSN
ETKSFTDSAFSHSNPNLDSELVWICPICFLSNTLKLDGGSIFNIKHQIGVPPKCGACGVT
TTWNNLQKSTMLAGIKKSQAHSKYTYDLPEVDIVSFNNYQCPRCTFVNHPSMVCCEMCGT
ALPSKKKHTQILGHSMESHLNQSSNGKYGADFRLEADNLVDDNVIKLSFRLGGEHNFYNK
SYQAIKDLDWESIQRKNGVNRGVVTSSVNNGINFSKALENVGPSTGIHGLQSSFIKKNYE
TSLILNDSLQDLNNLFEKGVQLIKLGQRYQKVLLGAEEKSIQSINSDSEILQTSHSTAKT
LTSMLLRKNKFMRAKGQYTGISSLQSLKRAVDVKKGTSTYKVVYNLYSKELSRHICEFLI
EEDILEKRNGLITLYELYALYNEACGFDIATPKEVSKAILLFSKFNFNYVITEIPLTKKE
ESTASMNIECTQKVYIISYKKLDSSSVIGKILQILSDHPGLSILQIQQERCLQISFIIIE
SLLNEMLNDGILVIDKTLQGEFFYPNKILSHDDSDSAIANRNFKLKIGNKKQKNEGTPSP
IFKAASDDKSDGNHRDDILKELAGLKF
Download sequence
Identical sequences jgi|Dekbr2|20711|fgenesh1_pg.3_#_709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]