SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|23857|fgenesh1_kg.1_#_605_#_Locus3394v1rpkm26.73 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|23857|fgenesh1_kg.1_#_605_#_Locus3394v1rpkm26.73
Domain Number 1 Region: 1803-1997
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 342-408,441-740,768-825
Classification Level Classification E-value
Superfamily Ras GEF 8.76e-18
Family Ras GEF 0.027
Further Details:      
 
Domain Number 3 Region: 1008-1022,1052-1204,1348-1535
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-16
Family Ras GEF 0.0089
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|23857|fgenesh1_kg.1_#_605_#_Locus3394v1rpkm26.73
Domain Number - Region: 1729-1798
Classification Level Classification E-value
Superfamily PH domain-like 0.000521
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|23857|fgenesh1_kg.1_#_605_#_Locus3394v1rpkm26.73
Sequence length 2011
Sequence
MRKFLSRRERRHSLVHGKHGKHKVHDSVSELESLQEETSSIFGSSSRVSKRASVIAEKGS
NFLKQDAPSNISSGGDDSQEQGSHRTGIFHTLSSKKSSSASLFHQNITDNNPVPRQRHGV
QKLVDPEWDVTTIKCDWLNIVDENSKDPEHLNLCRAELKGSMLYVYRPPQESAAVSHFVE
DEDEEAKTMVSTSGDAVSGAIADLKSNADTSSFNNQDDIQKEIKLHALAIAENAGVNKSD
ANSSPSSVTASPTKSVRYAQTHDIKSSDSMKKLTQKLENISLSEGASGEQIMNIHQLERN
IIEQKKFLTENKPTVQHHASHSSVNLESIDSNHQKGCEIPSFVKIKYRSCICPHPDLHFE
DQNGTILGGTIESICHTIAFYPSQDVADKLINILPMISPIEISLLYFETFLKMFISESAG
PSSNDRFGSPDHPDMSDRMMVIIPFESREIMVSRICDCLKAITEQFCGILLDESALRSVW
NVLVMSDEFCDCNELKLGIHNRQKTLRQLTDFEDSDIGSSLDSLTADKFLSYPIQTLAYE
INSLDHHFLDSWNPRSDRSLSSDKIHSSYSYWRKNFLIFDANNDLHYLARIIAHHLFEDV
SVKSNESKRAHVLEKWVLLGEYLYRNGNMVSWLGIASFICSVPILRSKRVWSLIDGKTID
MVRSSWAPIIYEVRQRLSVKPFVIRYRVLVPAGIGRDYAKKEVIPYYGDIRFSTDHGNDT
LPGDFVRSFCQFSQKADYSVSKWDEFYNGVRDSSSAKALGSSTGECGRMNAELARDLTRA
VSYRVKHPPYSLKDTFKESLEAEPPFDGQYYRYHNESRSPLFLGSYPSILFPKVLDTYEI
YDRKSLIGAIGGLDLAQNVLKKSASNLSSVMKSDTIKGERHSSETMRNTFLKHIRDLFNI
DTFEFQEGDDSIIFKCVLELSERIESHDSRRTSKSRPSSILFTENSSTKRFSSYSTSSFN
LDNYLSSYQSHVRDSLERDSIHTSSTSSRVVDSESNTYNQDQLTVPILAKAASTDRLIDL
LVLTSSIFSSRIKEEELRQYANSTSTSPRLVSLKMDQGTFTITFFAVYRCFCSPYKLICG
LRDRFDGAQSCALSIDASKSRKTKNGSEGVAGSKFQFPNWSDVSNETDSAKVNWKFVSQI
QLGVVESLHTLFEFYFDHFVDDLNTRDSIENLSEQIEVEIKIKWKDVSKSLRRKRYDREF
IGSIEKILKEMERSFTGTCEQYLKNCYSPMINAPMLKFTSQLTKIPEDRKLPDWRKNEKV
LEFIEGSDDTIRRITSDITIQDWIESFSILEVLTAKSNLSLFNYDVQSLDTPDELLGISN
IYHWIDTLVDVEKSDDHKNKKLYFVIDKFPLTVKAIFQFYVRLKNYFSIQICDPALPQED
RIEVMAAVLKISSICRTSMEDLNLFKLSDTDEECSISPRVPSLIESCLSNILVSPESRAF
GADWVSAAKLVDPEKCSYTSFETIDDLIPNIDSISSEALDYDPLTPCPGWIMQCLLSVTC
FIPNMYVKNTNLVNFDKDRFAYNCVVNSVTMVPKSTSRLNGNSKFEFLLHFAVRPLDLKA
IFESARTEGNSLGQGSLELFSSYIKEQRKLLSLEATKKSLFLRQIMKIPKRRVDTEKLSG
NVDTTMQHRLKLSGYNSNSVSGYPIATSETRQNFMESRHKTGASISSAASSIMTTGSKAG
RFRFGGLFSRKSHSLGLSRSSITIPDTAKKPLAIRELPSAATFLAERKPKILFTVNLKEF
SVFATYVTDNSFKLDSGNNSAKEYCFQAPSEPIRAEWLKLINYSHRHWFFSHTLNRPSMG
VPNNMVFGVPPEFVCMREGSVIPNIIEKILSELEYRGLEEVGLYRRSASLAAIQKIKDKI
NHMGDFNMEDQSVFDVHNLTGCIKCYLRELPDPSIGDAIVGDFLEVKKLSKDAGRFDVYR
NIFKKLPVYNYNLLERIIRHLKLVVEYKQFNKMTPSNLATILGGSLIEGCDPENLRKYFG
LMTFVCEDLIVNYEKVFSKADESSDTLEAAY
Download sequence
Identical sequences jgi|Dekbr2|23857|fgenesh1_kg.1_#_605_#_Locus3394v1rpkm26.73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]