SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|25578|fgenesh1_kg.5_#_186_#_Locus3025v3rpkm0.12_PRE from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|25578|fgenesh1_kg.5_#_186_#_Locus3025v3rpkm0.12_PRE
Domain Number 1 Region: 114-153,187-232
Classification Level Classification E-value
Superfamily PH domain-like 0.000000139
Family Pleckstrin-homology domain (PH domain) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|25578|fgenesh1_kg.5_#_186_#_Locus3025v3rpkm0.12_PRE
Sequence length 830
Sequence
MAHRESKSQKKGNPKGYSEFKVNEFQYRSDLNVDTVFSGWLTVTDEHYKLPQVHPDHYKS
SATFSGSAKMADSGTNENGFIKMVRDIGSQDSGEGSNDTPSDIDSKQLKQVRKKNRFYAV
LKHGNLFLYPDASEKNVQHVIVMNNYFVSIWPHNVTEGRLFTKSTSICLLKRSIGKHMDD
GSIIEKPFTEKELTYLFQHSGSNTVVPAGTYFLYADTNVKKEDWYFALLRATSSAQADQN
DPEDLLNPRVSAKPSFFNTADMIDLIQTINSTESQVTTMWINAIAGRLFLSVYQTAQFKA
FIRMKLEEKLQKIRTPGFLDELQVGHIDVGHSAPFITSPKLKQLSPDGTLVVSFIADYSG
EMCVEISTKVVLNLGSHFKEREIDVNLRVTLKRLYGPMKVYVKPPPSDRLWYCYESMPKM
DLDIEPVVSSRSVNYNVITNMIEKKFREAIQSSLVYPFMDDFVFFRPTDEIFRGGIWDPS
PIKRIKRHDHKQVQDQNTENKINEGNNEDRVSVFESVEDERVDDASSARLKFPSTLRNTR
RITPKTSSSSFSVSNVSPRRLSSISTAEYNGSQEEKSDLSIAATQIKNGVSNSVSKFKSW
YSKKTSGSSYSTNEVKLAPQMISNRRKRGSSASSSPSIKSKAFERQFGAYPPSSPGISRP
EMFISERMRTGRQMNADSSYSGQQTQGVSTAVEQIKDESLNRRSPSLPSDSSESVESEGI
HDSTEEENQEKNYSVEEDQQDNVEQTSSTSTSKSSTTSKSSELNNVESLLSGKESVRSDI
PKSPAENENAKVIQDDSKTAIETTSNPPELPVRTRTLSRKPPPQLPPRSN
Download sequence
Identical sequences jgi|Dekbr2|25578|fgenesh1_kg.5_#_186_#_Locus3025v3rpkm0.12_PRE

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]