SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|26503|fgenesh1_kg.13_#_11_#_Locus451v1rpkm362.97 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|26503|fgenesh1_kg.13_#_11_#_Locus451v1rpkm362.97
Domain Number 1 Region: 371-499
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000269
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|26503|fgenesh1_kg.13_#_11_#_Locus451v1rpkm362.97
Domain Number - Region: 139-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000575
Family Arfaptin, Rac-binding fragment 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|26503|fgenesh1_kg.13_#_11_#_Locus451v1rpkm362.97
Sequence length 519
Sequence
MASSSTSIPGTRNATPSSKKLEGASDDLLKPNIPDSTSIVTARYDKYLKLITAVQRFAES
YLKIASSNVKLTDELTKNTLSKELPNFEASSDSAVSGSAQANSTAGAAESRAVSPSPENE
DEALSVSEAGEVDLNVFVYSLRRNVTSLYNTTLKLQTQIKDDILPRLKTLYAEVEARKKD
FASVSSKHSKGVAKCRESSTKDVTRLHGAIGSFNANDSRTDYRRDPYLLKRASMKDAVAQ
VQRENDYVDFLENNERALKTLEAQISSVLRQTFSTLTSMVCGYYASKSEAFQKADSVFKA
VSSENEWHNFISKNSDFLVVSRSTDDPEESDVVSAAPSSLSALAKPSSGHHGNLLKRNYE
KVQFAGRDDSSTVPILEGNLLRKEGQLKKKYSSYYYVITQSKYLLEFSTGSLDTSSPSLV
LYLPDCLLSKSKHEHKFKFNIRGKDQTNLLAVRKRTYSFRASSSEEFLTWYNVVSEVTGL
MVSKAEQDQELQEVASMSSTESAESADAGVGGEVPQSPK
Download sequence
Identical sequences jgi|Dekbr2|26503|fgenesh1_kg.13_#_11_#_Locus451v1rpkm362.97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]