SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|26579|fgenesh1_kg.14_#_29_#_Locus1957v1rpkm78.00 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|26579|fgenesh1_kg.14_#_29_#_Locus1957v1rpkm78.00
Domain Number 1 Region: 777-1151
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.15e-82
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 392-498
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000283
Family Pleckstrin-homology domain (PH domain) 0.05
Further Details:      
 
Domain Number 3 Region: 233-281
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000000902
Family Supernatant protein factor (SPF), C-terminal domain 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|26579|fgenesh1_kg.14_#_29_#_Locus1957v1rpkm78.00
Domain Number - Region: 6-45
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0157
Family Supernatant protein factor (SPF), C-terminal domain 0.022
Further Details:      
 
Domain Number - Region: 525-623
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|26579|fgenesh1_kg.14_#_29_#_Locus1957v1rpkm78.00
Sequence length 1151
Sequence
METFEVRSKSFTIKWVKAPDNTYIRWELKPLKRSINSGIYRYNSRDEISESSASAQSAGA
SSASAVYGSENTSASVISEPRDRASASNLSASWEAADPQADGAGDDKSAKAVKSVQSFSR
ENISVDAVNRVPRKLFSTIHKTFFSTAAGERGASNEVLARSADADADAQVQAHVPEEAPA
GAARERPFPSANSTESGQRKPRHRSESRSSSISFNRVSSLEERIDRHLTQEKWVGSCAGD
EFISRAFRVERGGLFAFVFDNTFSRTKAKKVMFTQWVEDGEEPARAAQAERMGCMVERRA
GHSERSSKRSHSHMHLHHHGHDHVEQPEPHPSDPDDTLQEEEPRADGGGAEKQANEENLE
DEEEEKSAHIRFKLPEEKQSGKNTIMIRSKGVQYLQGILRKKRRRAGGNFVRRFFNLNFK
YAVLDYYADETSNNVRGNMLVTQAVISADVKQQMLYSDSGMEQWILKAVTKEDFDVWVQA
FDYIKKKNRQQRLSQQPGGAMQPQASAEQSLMSIPVDGYGIGAIDDYIDANDKQRTSISY
DLTKLQKLADTAASTLGDLKGEVEAHWAKKKMDKRERKERKERETEIVQDAANLITQIQS
RVGNIRGRFTALADEDADAYVASILSGAKRPLTRTTTAATSVSSQDFFDAQDVMEEMNEG
VVMVGAEAEAGAGADADTSASAGADAGQPAAAHPVEIKYGSKENIFVSQLESEPVSASSS
NECSDEDEAVAGEVAGVPTASAAPAAPDAQLGGIRDSYPLPYAGAVEYRKDIPPCAAPPP
SLIGILRKSLGKDLTGITMPITSNEPISFMQKYAECFEYAASLNRAAADSAESGARMSDI
ACFAVSYSSSYRAKTRSQRKPFNPLLGETFEMVRPEMGLRMLCEKVVHHPVVFAARAEGA
KWQVDHCFAPQQKFYGKAAEMFVDGKVYLKLVGGESGKNETYEWLQPTVAIKNVISLTGE
RYSEPTAQMTIHSSTGYRAVICFLPDKSHFSSRRSEKSTVKVYGPTSKSPLKTAAGTWTQ
SVRDDESGETVWEVGNLVPDPDDKFGFTEFAAGLNGMTEIDRGCAPFDSRRRPDQRIYEQ
GDVDKAEASKLDLEQRQRDRRSAPDGNPVTHKPAFFKKSGPGDLDYTFVEGPESYWERRR
RQDWEGLVQLW
Download sequence
Identical sequences jgi|Dekbr2|26579|fgenesh1_kg.14_#_29_#_Locus1957v1rpkm78.00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]