SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|27123|gw1.5.22.1 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|27123|gw1.5.22.1
Domain Number 1 Region: 774-1154
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.05e-110
Family Oxysterol-binding protein 0.00046
Further Details:      
 
Domain Number 2 Region: 246-349
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-20
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 6-133,166-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000188
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|27123|gw1.5.22.1
Sequence length 1154
Sequence
LIKLKLLDCIRSGDTRRLDKLIGQIVASKKEGLLQLQRELLHFSVQVGSLAIVKHVVEKN
LVDDINYQDPSENGNTPLHLAAITSRNDVVEYLMELPSINDCIVNNDLKQPIECTSDMDT
VQLMSDLRTKYVEAQASGLRKGFETRQFDTLTKIMSSPRARELLDINGTDPVSGETVLLE
FVRKEDVPMVRFILSHGGDPFKRSVSGKLPVDVARSPEMRRVIKEACDRQSVLDYTSVPM
PVLAAPTFKGFLKKWTNFAGGYKLRWFVLAADGTLSYYKSPTDMENSCRGMIHLAHAHVR
MDSSEKCRFEILVTTSRAGGSPVRWHLKANHQIESSRWVWTLQNAIRYARDRQKGRGQQE
LQRQQSPRRHKDLQLPLPHTESTPDLHRSSAELSNPAGPKQIHPHHERTQSRESVASSSS
HASVASSVARGARMLYRRPIHKLGKLGKLGRRSRDALSRSSRGSAAEFIADGDLDESIDS
SASSDSASSSPEQENIDGEVDKLLENLVVKKQRPNDHELIIVRNQIRIELESFKEFLDEA
VKDPGMSREEILAVCQRVLANLSQLSKNQDDLLDTRKITLERLFNRQHEISAIWENSVRQ
LELEIQDREKKICDLEDTIRKVRRSLRASVIISPEDSIPDSAEHNAPEMPKVTRKMSISS
IQAPDSELTKFLEEKDSSEDEFFDAEEEEEQEKEEQEEKEQEEKEQEEKKQEEKKQEDEN
LEEEDNDAKSQHTLKQTTTSDLPEAKKRYEEFLRDATFKGYEDPIRTTLKKDDDRPKISL
WGVLKSLIGKDMTRMTLPVTFNEPTSLLQRNIEIMEYSDVLDKAAASDDSCLRMVYVAGF
AASEYVSTIGRIAKPFNPLLGETYEYARPDKGYRVLCEQVSHHPPISAIVAESPRWAYYG
ESNVKTRFYGRSFDIKHLGSWFCELYPDHGVVNKSTGKKEPMELYSWKKVNNSVVGIIIG
HPTIDNYGEMVIRNHMTGDYMNFSFKRRGWRASTACEVKGDVYSADGTLRYQVGGFWDRK
IYAKSASTQTAKKFLIFSANKRQEMLFHLTNFAAGLNAPQPHLLPVVACTDTRLRPDQRA
MENGLYDLAAEEKNRLEEKQRAVRKHREETGGVYRPSFFVEAKHPITKEPYWRYKQTYWE
ERRDGKLKHYKDIF
Download sequence
Identical sequences jgi|Dekbr2|27123|gw1.5.22.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]