SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|29447|gw1.1.572.1 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|29447|gw1.1.572.1
Domain Number 1 Region: 620-1053
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.4e-97
Family Gtf glycosyltransferase 0.001
Further Details:      
 
Domain Number 2 Region: 119-251
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000134
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|29447|gw1.1.572.1
Sequence length 1090
Sequence
SILGISRSFAGFLTTASVYAGFEDLQEAQQEENEIIDSEAADYGGTKQSKNTIYSKSTAS
KSKLELSITIHKPLLSKEKARMFAEMLRQRFKIPDDCEFVSDYNCWLMGDVLLQGHLFIT
TQFVFFSAYLPKRQPEKIIQQGTLSVKSAILHRRWIILKEGTLSVFSHSNDLYFPDMVLD
LKAALRAEIYHKSKKSGIGKEKTSESAPVWFKVLTPKKTYWFQADSMSSARSWVSAIKKQ
IFQSRNKGDQAIVKIPLRSILDFELTTVLGETKNLRIKVIENADSYAIDDYFLLLFSDGA
KVAGDIRNVVDRAGVKLTDGRNEEECAQFVKRKAELMKEINEGIETSNCMIRDPESIQKE
TKKIKDESQLESVEVQSPNSATSSTFQRVSKAAASGISTITRNLSYKQQQIVHVGSEFVG
DPFYILDKTAREKKQSGFLKAFSLHDQELRAIYHGYCLRGLPVYGKVFISTDYLCFQSSL
PGSGTLMILPLTVLENASKEKGFRFGYCGLVVVIKGHEELFFEFSTEKARDDCECQLLRQ
KDRMRNNDKRRHRSYKGSHASTSTASHSNSPESSESAPTLTSARIKLVESKLNDEIGADV
PILIEDNPLQRTVLKPLRHYRFTLLTIGSRGDVQPYIALGKALKKEGHSVRIVTHGEFEP
WIKSHGLEFAPIAGDPSELMSLMVSHPTISYSFVREAKSKFSSWINELLDTSWKACQGTD
VLIESPSSFSGIHIAEALGIAYFRAFTMPWSRTRAYPNAFMVPDQKLGGSYNYMTHVVFE
NGYWRGVSTQVNKWRENTLHIPRTTLAALKQNSVPFLYNMSPVVFPPSVDFPEWVKVTGY
WFLNEGHDDYKPPEKLKSFIKDARRNHKKLVYIGFGSIVVEDPHKISSVITQAVLRAGVW
CVLNKGWSERGKSKRNSQRTDSSENPRDTSRKMDEFPPEILSIGSIPHDWLFPRIDAAVH
HGGSGTTGASLKFGLPTVIKPFFGDQKFYANRVEDLGCGIALKELTVSSLASALKEITTN
NRLMQKAEAIGSMIRKENGVQNAIAAIYSEMKYAKNLSLQKRRVSVADDDKVECKLDEVT
SEDGESWLLV
Download sequence
Identical sequences jgi|Dekbr2|29447|gw1.1.572.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]