SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|33453|gw1.12.180.1 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|33453|gw1.12.180.1
Domain Number 1 Region: 285-592
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.53e-103
Family Mammalian PLC 0.0000025
Further Details:      
 
Domain Number 2 Region: 151-271
Classification Level Classification E-value
Superfamily EF-hand 9.53e-20
Family S100 proteins 0.078
Further Details:      
 
Domain Number 3 Region: 613-739
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-19
Family PLC-like (P variant) 0.0056
Further Details:      
 
Domain Number 4 Region: 10-123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000123
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|33453|gw1.12.180.1
Sequence length 739
Sequence
PLVRNEIPKRFLHPGIEMLRITHRKKVKRMLRLDIDTNRLYWNTKSTSFLEIEKIKYIRL
GDNARNYREEFGVAPKFKDLWITVIYHNYSKSNNIKALHVIALNKTDYNTFLYTLNNMVY
FMRQLQSGLCSSVNSDSFIQYHWNNTVTNDGKLTFKSALKLALKLHIYISKESLSRQFRY
EDKEAKGFLNFLQYKSFIRKLGHRSEFKEIFERYCDGNVKDLMNKKDFKKFLCEEQKERI
CDECALDHIFNEFSSNDQTLNFDEFTSFLMSLYTNGIRNLVEDYTKPLNEYFISASHNTY
LLGRQFNGISSIEGYIRALQRGCRCIEIDVWDGDNGPIVTHGMTFTGSIDFKSVVETVRK
YAFITSPFPVIISLEVRCSEENQMKCVNILKEVLGSTLLHGRLDNNQTTLPSPLELKHRI
LLKVKKSRMSSIPTSYIDNSMYGSQSTTTSSFSEDSTFTYPLVSSIPIITELSSMAFYTV
GLKFRNFSLPESKTFNHCFSFSDRTVSKMLKEITKFNAIMKHNRNYLMRIYPSVYRFKSD
NFNPLAFWSLGCQIAATNWQVYDAGQQINEALFNVGTCSGYILKPKSLRMHKDKFRKTKD
FQNVMRFDKLNFIELNIISAQQLPKSKDMKVKTFDPYIEVELYSGKKLINLGSPSLVFRT
SSVLQNGFNPIWNEKLKCKFCANKEDMVFLRFLVKCNTPDKSDVLLGIYCCRLSYLKQGY
RHLPIYDLQGEEYIYSSLF
Download sequence
Identical sequences jgi|Dekbr2|33453|gw1.12.180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]