SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|38992|gw1.1.2533.1 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|38992|gw1.1.2533.1
Domain Number 1 Region: 20-143
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000314
Family DnaQ-like 3'-5' exonuclease 0.0038
Further Details:      
 
Domain Number 2 Region: 421-459
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000667
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number 3 Region: 340-372
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000549
Family Ran binding protein zinc finger-like 0.0021
Further Details:      
 
Domain Number 4 Region: 236-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000261
Family Canonical RBD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|38992|gw1.1.2533.1
Sequence length 464
Sequence
YIVVSISGTGGEQMQYTAKDASEIIEIAWRIVSAKDLTQVAAGSELVKPINTPITPLCTC
VTGLTWSSVKDAKTLKDAIEKFSQSIHENLIATKRPFSFVTFSSWDLRMRLPKEAREKSI
QLPEYMRYPRYFDLRKEFVRYQEATKDEFYSNSSINEITIGQVVESLSVDSAAGPDLCEC
AADSGEKDETSGYVAEDGECRNGGSSASKTISLLVEIMRKLKQEAGPELRLLSRPHDMGL
DLTQFYEDGSRILYITNLPLDVTQSELESWFTQFGCKPMAFWTIKAPLPEMGGSSNGNGN
NTAESLAMNGRVLNDRIIEVQPSSAGVLDKAQEILTPFPSSKNRPRPGDWTCPSCGFSNF
QRRTACFRCSFPATSAQAVQESKYGAPGAPGGPGGVPGATGQHHHGHQNGHRGIHQGPAI
GSSNVPFRAGDWKCMNENCAYHNFAKNVCCLKCGAPRVASAILS
Download sequence
Identical sequences jgi|Dekbr2|38992|gw1.1.2533.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]