SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|39717|gw1.1.2724.1 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|39717|gw1.1.2724.1
Domain Number 1 Region: 271-468
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.27e-46
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 453-528,559-623
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000571
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 3 Region: 759-842
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000589
Family PB1 domain 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|39717|gw1.1.2724.1
Domain Number - Region: 163-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00414
Family Calponin-homology domain, CH-domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|39717|gw1.1.2724.1
Sequence length 848
Sequence
PPIRTISSNTLGSMSSLTPSAPIGAASMVMNVKVTHKDSLYYICTSLMRRLKKVPGIKPY
MELAYTRAEENAEKQALAISTATTSSTLDSNEISRTQSRKSGRTGLVADSARSRTLMSLS
ERSRKSQLSIASSTSSRDSEYGPMNHWNSTLFTFAAGVLPSQIPHDPVTPICNLFQQGAP
LCLIFNVIRPEHKIDVVSSDDLKVCKMSVYQFLSACKLHLNIRDDELFPITSVFSDDIRN
LLEVIHSVNLVLDLDPRFDVSPVEDQLVVSDERSKVVKELVESERKYVYDLETLCKYKDE
LMKKELISSDDINMLFPNLNEIVDFQRRILVGLECNAVVPSEYQRLGSVFVHAGVEGFQI
YEAWSLFQNSAIEFITKEADSLMQSSSVIGSPYELQSFLIKPVQRLCKYPLLLKSLLKLS
KETWPNYGELQDAYDIACEVGNTINEAQRKSENIQLLKRLQEQVVDWKGFSLSGVGELLY
ANVVMVKDLLNEGHSGEKEVHCYLFEHVIYLFKEHREKSGFLGGHRKSSGSAGTSSHHKS
YGSDKNRNSGGTSSANRRLSLNGVVYINKIYRVTSSDTSPYFSAGQGHYLTLRWRGNRDT
GGCVFKFRSEEHMGQWEAAILRLSGCTGGTPDYSYGSAPASAHQSTASIPESSTSYFSAA
STVRHRTSSAGGNPSMPNTANGGVVNGGGYPSLPPVPLSGFPQLVSKKKRSVSSPAAYLP
RVRTLSSSDLPPVPQYDNLSSKFSGMNISPSNLKFTQASVSYTSDGECVHVSVNPDTTYG
ELTRILVDKLNYVMVADGVAKRFDASLIKLKFQDEDGDMIRFQDDADWAIAKDMLAEISD
EERRILTL
Download sequence
Identical sequences jgi|Dekbr2|39717|gw1.1.2724.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]