SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|4330|gm1.739_g from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|4330|gm1.739_g
Domain Number 1 Region: 234-468
Classification Level Classification E-value
Superfamily PH domain-like 9.1e-77
Family SSRP1-like 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|4330|gm1.739_g
Sequence length 547
Sequence
MSTEYERIYLNQSKLPGRMRLAESGLGWKAQTLPGSTAKTSPFLLPTEEILTTSWSRGSR
GYEVCIDTKNRGVVMLDGFGKEDFASLKRELEKFFDIQLEQREHSLRGWNWGKTQLARNE
LVFNVSNKPAFEIPYSQIANTNMTGKNEVSVEMDLVDKSEIEKAGDELVELKLFIPGNME
KDEVEEINKKEEEEQSKTDNGSNTTSDKIVPLRTKALYFYDELKEKADLGQVVGEMIVSF
GEVLFLTPRGRYDIDMYDSFLRLRGKTYDYKVQYKQIQRIFSLPKVDGLHQLLILQVDPP
LRQGQTKYSFLTLQFDSQEEIEVELNLDDDEYEKKWKTRLNKTYSNYTYMVLTSIFKGFT
DRRVVVPGSFLTKDSDVAISCSVKANEGHLYPLDKCLIFVTKPTILLPFSDVHEVVFSRV
DTAGTHKTFDMEVVLKYGGGSHTFGNIDRKEQSALETFLKTRNLRVRNDEKIAQEMMAAA
LADDDDDGDLDLGSADEDSPDEDFKPGDENQEDDDIAEEYQSDVSASGEDDDEDMEDEEP
ERKKHKK
Download sequence
Identical sequences jgi|Dekbr2|4330|gm1.739_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]