SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|4430|gm1.839_g from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|4430|gm1.839_g
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-32
Family Chaperone J-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 137-206
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.96e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.0000375
Further Details:      
 
Domain Number 3 Region: 254-332
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.79e-17
Family HSP40/DnaJ peptide-binding domain 0.000055
Further Details:      
 
Domain Number 4 Region: 112-145,209-250
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.32e-16
Family HSP40/DnaJ peptide-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|4430|gm1.839_g
Sequence length 405
Sequence
MVAETKLYDTLGVSPDATPAQLKKAYRKMALKYHPDKNHEPGAAEKFKDITSAYQVLSDD
RKREIYDQVGEEGLKGNGGMGDMGGMDGSDIFSQFFGFGGGRQSQGPKKGKDIRHTVSCT
LEQLYKGRTAKLALNKTVICKACNGKGGKNVKKCATCNGTGMKFVTRQMGPMIQRFQTTC
DVCHGEGDIMNEKDRCGKCHGKKVIEERKILEVHINPGMKAGEKIVFHGESDQYPDTIAG
DVIIVVDEKPDKTFTRKGDDLYYEAKIDLLTALAGGQIGFKHLNGDFLKLELVPGEVIAP
ESVRVLEGKGMPIEKMGDYGNLFVKFTVKFPPNHFASEQQLKNLEKILPARPKLQIPKGA
EVDDSCQLVDYDPVKHSGRKSRAGNGYYEEDDEAGGQPNVQCSQQ
Download sequence
Identical sequences jgi|Dekbr2|4430|gm1.839_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]