SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|5658|gm1.2067_g from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|5658|gm1.2067_g
Domain Number 1 Region: 45-189
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-29
Family Dcp1 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|5658|gm1.2067_g
Sequence length 189
Sequence
MTKNTSSGDVAVNIQSNNNKNETENTDSSSDQQSVQAFDIFKKALTYNVIAKYDPTIDQL
IHLSPYCVIYQFDGTDWNKLDYQGPIAFYSRKVSEIKEGAKFSIQDVMERDIYQYGLILL
NRAKPENFTIGLLARKYLADIDLDRAIAVEKKEELVILNDFKGDTFGIWLFDEKDREYLY
KFLSYCIEN
Download sequence
Identical sequences jgi|Dekbr2|5658|gm1.2067_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]