SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|63391|fgenesh1_pm.1_#_171 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|63391|fgenesh1_pm.1_#_171
Domain Number 1 Region: 359-581
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.31e-32
Family Exocyst complex component 0.00073
Further Details:      
 
Domain Number 2 Region: 203-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000776
Family Pleckstrin-homology domain (PH domain) 0.093
Further Details:      
 
Weak hits

Sequence:  jgi|Dekbr2|63391|fgenesh1_pm.1_#_171
Domain Number - Region: 70-143
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0209
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|63391|fgenesh1_pm.1_#_171
Sequence length 582
Sequence
MADRRLSRAVWSTKDNAKPYTRPSDNRGQTNLLTASLFDLLSSPDYNAAQYLNDHLKNAD
ASKIDDFTSQLASLTIKSKNDAKSTISESLESVLNVSDSVADTYKVLDNLKQTINALNDV
LYQQLDDAQEAVKAETDARASGSENTPLSTKGRKNADKRRSVLILEKRWASDMGQLFKEV
DGAQQFVSAAPGRHVVTQSKRWGELNALTWKPVRPAHLIISNDYLSVATRKRIEDKKRTI
ATGCWPLRSVTLIDSIQPPKSHTEKSDKFTLAFKTSNTSLLFQTDSQNEYNKVKSSFGAA
KADWAQKNESEETRNRQIRKSINRISSDHLGRNSSVLHDLSSQLSHHRVRSRDVKQQSES
DSMDSIDESLTNIEVFLGHHKFEECTGFVNRLKDQLESLKKSTKATGMDKDGHSKILIKL
KELKSDDLIDQLVGWLSWKVSNPVASNQVISDTINLFRILGLKDKGRNVLLDAKTKQLDE
RVREVKFEGDLKNFLMQVSMIYFNFIQQVYVLYEKCFTEIRDKSFVIDWTNDRIASYNKV
VQRQLIDYKKDSKIYKDCVLMTKSRAQPLRSLGLNVDYLFDF
Download sequence
Identical sequences jgi|Dekbr2|63391|fgenesh1_pm.1_#_171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]