SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dekbr2|67049|fgenesh1_pm.11_#_98 from Dekkera bruxellensis CBS 2499 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dekbr2|67049|fgenesh1_pm.11_#_98
Domain Number 1 Region: 166-293
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-26
Family Ran-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dekbr2|67049|fgenesh1_pm.11_#_98
Sequence length 298
Sequence
MDSTTDKHSVQKTSEVKKEEHKEQKKEIGAKEDISEDKKEEMKNDKEDEKLGEAKKSAKE
APNGNEEVKKGEIRGKKRVHEADAKDTPKKAKITEITDKKDAKATESRPEDKKEVESKNS
KAEKPKFVFGQSASFGKATSLGKDGKKEGNNVKDNAKGEDTVYRTIHLQKQDVKSGEEDE
TTLYQVKAKLYRMDLEKLSEGWKERGVGILKVNQLKKPTDSYRSRLIMRQAGNLKSILNL
PIAKNIKVLKGMTSSFAGKKFIRIQTIEQGKPIQYALKIGQVENVPKVYDSIVSEIPK
Download sequence
Identical sequences jgi|Dekbr2|67049|fgenesh1_pm.11_#_98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]