SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000031 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000031
Domain Number 1 Region: 589-655,792-1021
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.37e-64
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 1061-1388
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-39
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0039
Further Details:      
 
Domain Number 3 Region: 336-545
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-37
Family Protein kinases, catalytic subunit 0.00055
Further Details:      
 
Domain Number 4 Region: 16-144
Classification Level Classification E-value
Superfamily UBC-like 1.21e-35
Family RWD domain 0.00000111
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000031
Domain Number - Region: 1394-1495
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000275
Family Anticodon-binding domain of Class II aaRS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000031   Gene: ENSTTRG00000000035   Transcript: ENSTTRT00000000035
Sequence length 1649
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2853:790229:1019257:1 gene:ENSTTRG00000000035 transcript:ENSTTRT00000000035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRGAHGRGRDEPPESYPQRQDHELQALEAIYGSDFQDLRPDACGRVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIALMNAKGLSNETVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLCEHNKPPPKSFHEEMLERRAQEEQRRQLEAKRKEEEEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSRKDPGGHRTAAILHGGSPDFIGNGKHR
TNSSGRSRRERQYSVCSSEDSPGSCEILYFSMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGSFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGAETEFNSLVKLSHPNVVR
YFAMNLKEHDDSIVVDILVEHTNGVSLSAHLSHSGPIPGHQLRRYATQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTIKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
VWRLGLLLLSLSQGQECEEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKIPSLEQSPEDSGGQDYVETVIPSNQLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPVGPATPPPDAGPQALDGRALPRLPASDTDGPGSVEAAAPPPILSSSVEWSTSAERSGS
ARFPAAGPDSSSDEDDDEEHDGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNGKN
SCHESEPPATTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFAADGKQDDTSGDHLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMCYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHTKQKSVISWLLNHDPAERPTATELLRSELLPPPQMEESELHEVLHRTLA
NVGGKAYRTVMAQTFSQRISPAVDYTYDSDILKGSFSIRTAKIQQHVGETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLNQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGELQDLTPTINSLIKQKTGVAQLVQYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHSGLIFQFVAFIRRRQRAISEILAAGGRYDLLIPLFRGPQALGPVPTAIGVSIAIDK
ITAAVLNMEEPVTVSSCDLLVVSVGQMSMSRAINLTQKLWSAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGNHVKVKSFEKERQTEKRVLESDLVDHVVQKLRTKVSDERTI
REASDNLAVQNLKGSFSNASGLFEIHGATVFPIVSVVAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
Download sequence
Identical sequences ENSTTRP00000000031 ENSTTRP00000000031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]