SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000047 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000047
Domain Number 1 Region: 528-694
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.95e-32
Family cAMP-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 40-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.64e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 
Domain Number 3 Region: 441-490
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000667
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000047   Gene: ENSTTRG00000000052   Transcript: ENSTTRT00000000052
Sequence length 1082
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1119:119091:139301:1 gene:ENSTTRG00000000052 transcript:ENSTTRT00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNFLDTIVTRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVM
QRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKG
EVALFLVSHKDISDTKNRGGPDSWKETGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGHL
QKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAVT
VPYSVCVSTAREPSAARGPPSVCDLAVEVLFILXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLQELARRLETPYYLVGRSPAIGN
SSGQSDNCSSSSSEANRTGPELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKI
FSICTMLIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRIPKPLKQRMLE
YFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRP
AFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKANA
DVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGGPAEVDTSSLSG
DNTLMSTLEEKETDGEQGPTASPAPADEPSSPLLSPSCTSSSSAAKLLSPRRPAPRHPLG
GRGRPGRAGALQAEAGPSAHPQSLEGLRLPSVPWNVPPDLSPRVVDGIEDGCGSDQPKFS
FRVRRSGPECSSSPSPGPENSLLTVPLGPSEVRNTDMLDKLRQAVMELSEQVLQMREGLQ
SLRQAVQLILAPHGEGPSPRASGEGPCPASASGLLQPLCVDTGTSSYCLQPPAGSVLSGT
RPHPRPGPPPLVAPWPWGPPASQSSPWPQATAFWTSTSDSEPPGSGELCPEPSTPGPPPP
EEGARTGPPEPMNQAEAASTGEPPPGAGGLALPWEPQSLEMVLIGCHGSGTVQWTQEEGT
GV
Download sequence
Identical sequences ENSTTRP00000000047 ENSTTRP00000000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]