SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000058 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000058
Domain Number 1 Region: 76-209,245-346
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.27e-57
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000544
Further Details:      
 
Domain Number 2 Region: 356-453
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.35e-26
Family Anticodon-binding domain of PheRS 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000058   Gene: ENSTTRG00000000063   Transcript: ENSTTRT00000000063
Sequence length 454
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1800:32237:348690:1 gene:ENSTTRG00000000063 transcript:ENSTTRT00000000063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCWALRRAAQVRVHLARKASGVCRGPEHQASGARPAAPEPATRGALGALGGTVELLGKS
YPQDGYSNLSRKVLSRVGRNLHNRPHHPLWLIKERVKQHFYAQYVGRSGTPLFSVYDDLS
PVVTTWQNFDSLLVPADHPSRKKGDSYYLNATHMLRAHTSAHQWDLLRTGLDAFLVVGDV
YRRDQIDAQHHPVFHQLEAVRLFSRHQLFAGVKDGENLQLFEQSSRSAHKQETHTLEATK
LVEFDLKQTLTRLMTHLFGDGLDIRWVDCYFPFTHPSFEMEINFHGEWLEILGCGVMEQR
LVNSAGAEDQIGWAFGLGLERLAMVLYDIPDIRLFWSEDERFLKQFCVQDINQKVKFQPL
SKYPAVINDISFWLPRENYTENDFYDLVRTIGGDLVEKVDLIDKFEHPKTHRTSHCYRIT
YRHMERTMSQREVGRVHQAVQEAAVRLLGVEGRF
Download sequence
Identical sequences ENSTTRP00000000058 ENSTTRP00000000058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]