SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000224 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000224
Domain Number 1 Region: 75-123
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000497
Family Elafin-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000224   Gene: ENSTTRG00000000240   Transcript: ENSTTRT00000000240
Sequence length 123
Comment pep:known_by_projection scaffold:turTru1:scaffold_90752:7342:8587:1 gene:ENSTTRG00000000240 transcript:ENSTTRT00000000240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRNFLILVVVLLVLGTLVAQAAVVRVKGQGTTKGNVLIKGQDPVEGQDPVEGQDLVEG
QDPVEGQEDPVGFRQSTKRGSCPWVPFQCGLKHPFNKCVTDDQCWGRKKCCVGYCGNACM
NPW
Download sequence
Identical sequences ENSTTRP00000000224 ENSTTRP00000000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]