SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000291 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000291
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 594-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000102
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 911-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000196
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 4 Region: 415-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 782-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 6 Region: 1174-1308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 948-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 1025-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000857
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 1145-1188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 10 Region: 757-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 11 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000418
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 291-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000753
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 981-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 14 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 182-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 16 Region: 65-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000242
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 18 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.016
Further Details:      
 
Domain Number 19 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000102
Family Notch domain 0.0015
Further Details:      
 
Domain Number 20 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.014
Further Details:      
 
Domain Number 21 Region: 1376-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 22 Region: 1064-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.024
Further Details:      
 
Domain Number 23 Region: 105-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 24 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 25 Region: 1115-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.018
Further Details:      
 
Domain Number 26 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 27 Region: 28-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000922
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000291
Domain Number - Region: 1466-1497
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000291   Gene: ENSTTRG00000000310   Transcript: ENSTTRT00000000310
Sequence length 2471
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1346:85364:260137:-1 gene:ENSTTRG00000000310 transcript:ENSTTRT00000000310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPAPLWALLALWLCRATPALALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGFIGEDCQYSTTHPCFGSHPCLNGGK
CHVLSRDTYECICQVGFTGKLCQWTDTCLSQPCANGSTCTTVANQFSCTCLAGFTGQKCA
SDVNECDVPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFAFECNCLPGFEGVTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGGDCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCKNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATXXXXXLCEENIDNCDPDPCHHGQCQDGIDSYTCVCNPGYM
GAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASSPCVHGVCM
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCVHGNCTGGLSGYKCLCDAGWVGINCEVDRNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCLVNIDECASNPCLNQGTCFDDISGYTCHCALPYTGKNCQTVLAPCSPN
PCENAGVCKEAPDFESYTCLCAPGWQGQRCTVDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCLPGFTGDRCQTDMDECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCEDNIDECTESSCFNGGTCIDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGVCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
EKAQSRCLCPSGWAGAYCDVPNVSCEVAASHRGVPVDRLCQHSGICISAGNSHHCQCPLG
YTGSYCEDQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCAS
SPCQHGGSCYPQRQPPYYSCKCSPPFWGSHCEFYTAPTSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDAQGDLMVYPYYGEKSAAMKKQRLVRRSLPGDQEQEVAG
SQVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPKRTQLIY
LLAVAVVIVLFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDETLLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPNAKSVVPCSLPNLAKEAKDAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPVLATAAPPAPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHHHIVPPGSGSAGSLGRLHPVTVPADWMNRVEVNESQYNEMFGMVLAPAEGTHP
GITPQSRPPEGKHLPAPREPLPPIVTFQLIPKGSIAQPAGAAQPPSSCPPAVAGTLPTMY
QIPEMARLPSMAFPTAMMPQQEGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGAHMS
EPPRSNMQVYA
Download sequence
Identical sequences ENSTTRP00000000291 ENSTTRP00000000291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]