SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000294 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000294
Domain Number 1 Region: 154-355
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-49
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 449-490,528-590
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 602-700
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-18
Family Pleckstrin-homology domain (PH domain) 0.0000527
Further Details:      
 
Domain Number 4 Region: 338-423
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-17
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000294   Gene: ENSTTRG00000000313   Transcript: ENSTTRT00000000313
Sequence length 720
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1177:128:26111:1 gene:ENSTTRG00000000313 transcript:ENSTTRT00000000313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGGVSSIPPAPIATRGEPDAGPSSSSLGKLRALPVGPGAHCGDPASGSPGSQASVGDV
GSVSEPSSGTKIPNRDSGIDSPSCSVVGEHFSCEDGSEAGPGPTIKGLHLETAPGGKAPR
EEADSDMGEGSSEEPDPENSPLRADADPAKCAEPQKLLHIAQELLHTEETYVKRLHLLDQ
VFCTRLMEAGIPSEVTTGIFSNISSIYCFHGKFLLPELQTRITNEWDTNPRLGDILQKLA
PFLKMYGEYVKNFDRAVELVSTWTQRSPVFKDIVQGIQKQEMCGNLTLQHHMLEPVQVPR
YELLLKDYLKRLPKDAPDWKDARSLELISTAANHSNAAIRKMEKMHKLLEVYERLGGEED
IVNPANELIKEGHIQKLSAKNGTTQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMDISD
LQXXXXXXXXXXXXXXXXXXXXXXXXXXXTEEEKKEWIQVIEATIEKHKQNSQTFKAFSG
SFGQDEDSSLTPDPPMVSANPEVPAAVPTGGGGAAGLEPRRGSSKTRRDKEKQGCSSCGE
TFNSITKRKRHCKLCGAVICGKCSEFKAENGRQSRVCGECFLTQPVAPSTEKPATVDPPP
SLLCGPLLVSDGGTAWSKVWAAISESDSLELVLHLRGGSQDGQLLHAVPLSGCRVSVPEP
AERLDAGHMWQLQQAQQSLYLSAPSAELQQQWLEALSSAAHGHLAQASPGAQQPQAPAAP
Download sequence
Identical sequences ENSTTRP00000000294 ENSTTRP00000000294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]