SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000295 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000295
Domain Number 1 Region: 32-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000295   Gene: ENSTTRG00000000315   Transcript: ENSTTRT00000000314
Sequence length 250
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1177:44523:64696:1 gene:ENSTTRG00000000315 transcript:ENSTTRT00000000314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREEATTLSRRARPGGRMGDATPAPGNCTGMCVQVQPPLQGTFQVLRGNGTSVGTVIVFH
CPSGHQMVGSGLLTCVWKGSIAEWSSETPMCKTVPPYETFGFKVAVISSIVSCAVIMLMS
MAFLTCCLMKCVKRSEQRRSNRAAQLWFQLRDEDLETVQAACLGLKGLNKSRIQPIQAHD
NHSFTTDLGEGTRELASMARGIDKDPWTPSGPTSSPRAQVMVHTANPGQMLPASRPTVGM
LRQPAAYVPG
Download sequence
Identical sequences ENSTTRP00000000295 ENSTTRP00000000295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]