SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000303 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000303
Domain Number 1 Region: 56-103,143-407,442-463
Classification Level Classification E-value
Superfamily Clc chloride channel 8.24e-87
Family Clc chloride channel 0.00022
Further Details:      
 
Domain Number 2 Region: 586-747
Classification Level Classification E-value
Superfamily CBS-domain pair 4.55e-30
Family CBS-domain pair 0.00000118
Further Details:      
 
Domain Number 3 Region: 527-587
Classification Level Classification E-value
Superfamily Clc chloride channel 1.83e-17
Family Clc chloride channel 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000303   Gene: ENSTTRG00000000322   Transcript: ENSTTRT00000000322
Sequence length 760
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_264:3599:47895:1 gene:ENSTTRG00000000322 transcript:ENSTTRT00000000322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEF
IKSLLDAWSGWAVMLLIGLLAGTLAGVIDLAVDWMTDLKEGICLSAFWYSHEQCCWTSNE
TTFEDRDKCPLWQKWSELLVKQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACG
SGIPEIKTILSGFIIRGYLGKWTLLIKTVTLVLVVSSGLSLGKEGPLVHVACCCGNFFSS
LFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALV
AAFTLRSINPFGNSRLVLFYVEYHTPWYMAELFPFILLGVFGGLWGTLFIRCNIAWCRRR
KTTKLGKYPVLEVIAVTAITAIVAYPNPYTRRSTSELISELFNDCGALESSQLCDYINDP
NMTRPVDDIPDRPAGVGVYTAMWQLALALIFKIVITIFTFGMKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTRMTVSLVVIMF
ELTGGLEYIVPLMAAAVTSKWVADAFGKEGIYEAHIHLNGYPFLDVKDEFTHRTLATDVM
RPRRGEPPLSVLTQGSMTVEDVETLIKETDYNGFPVVVSRDSERLIGFAQRRELIPAIKN
ARQRQEGIVSDSVMYFTEEPPELPANSPQPLKLRRVLNLSPFTVTDHTPMETVVDIFRKL
GLRQCLVTRSGRLLGIITKKDVLRHMAQMANQDPESIMFN
Download sequence
Identical sequences ENSTTRP00000000303 ENSTTRP00000000303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]