SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000315 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000315
Domain Number 1 Region: 51-287,330-408,453-546
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.72e-117
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000335
Further Details:      
 
Domain Number 2 Region: 530-639
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.81e-29
Family Anticodon-binding domain of Class II aaRS 0.00025
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000196
Family a tRNA synthase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000315   Gene: ENSTTRG00000000334   Transcript: ENSTTRT00000000335
Sequence length 661
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_683:2580:42667:1 gene:ENSTTRG00000000334 transcript:ENSTTRT00000000335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDVVDRAKMEDTLKR
RFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLK
TSHVDKFADFMVKDVKNGECFRADHLLKAHLKLMSDKKCSAEKKSEMESVLAQLDNYGQQ
ELGDLFVNYNVKSPTTGNDLSPPVPFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLL
EFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLH
LYLYSAKAQVSGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLVKVGVSPDKLRFRQH
MENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTV
NVVQFEPNKGAIGKAYKKDAKLVMEYLAVCDECYITEMEKLLNEKGEFTIETEGKTFQLT
KDMVIVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTVFEHTFQIREGDEQRTFFSFPAVVA
PFKCSVLPLSQNQEFMPFVKELSEALTRHGISHKVDDSSGSIGRRYARTDEIGVAFGITI
DFDTVNKAPHTATLRDRDSMRQIRAEVSELPSVVRDLTGSITADVEARYPLFEQETEKEI
E
Download sequence
Identical sequences ENSTTRP00000000315 ENSTTRP00000000315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]